1. Recombinant Proteins
  2. Others
  3. HLA-DMA Protein, Human (His)

HLA-DMA proteins are key members of the MHC class II family and are essential for antigen presentation and immune response regulation. In this family, HLA-DMA is actively involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. HLA-DMA Protein, Human (His) is the recombinant human-derived HLA-DMA protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HLA-DMA proteins are key members of the MHC class II family and are essential for antigen presentation and immune response regulation. In this family, HLA-DMA is actively involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. HLA-DMA Protein, Human (His) is the recombinant human-derived HLA-DMA protein, expressed by E. coli , with N-His labeled tag.

Background

The HLA-DMA Protein is an essential member of the MHC class II family, playing a crucial role in antigen presentation and immune response regulation. As part of this family, HLA-DMA is involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. Recognized for its significance in the immune system, the HLA-DMA protein contributes to the activation of CD4+ T helper cells by presenting antigens derived from extracellular pathogens. Through its association with the MHC class II family, HLA-DMA underscores its integral role in facilitating adaptive immune responses and enhancing our understanding of immune system dynamics in health and disease.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q6ICR9 (V27-C233)

Gene ID
Molecular Construction
N-term
His
HLA-DMA (V27-C233)
Accession # Q6ICR9
C-term
Protein Length

Partial

Synonyms
HLA-DMA protein
AA Sequence

VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Predicted Molecular Mass
27.4 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HLA-DMA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HLA-DMA Protein, Human (His)
Cat. No.:
HY-P71463
Quantity:
MCE Japan Authorized Agent: