1. Recombinant Proteins
  2. Others
  3. HLA-DMA Protein, Human (His)

HLA-DMA proteins are key members of the MHC class II family and are essential for antigen presentation and immune response regulation. In this family, HLA-DMA is actively involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. HLA-DMA Protein, Human (His) is the recombinant human-derived HLA-DMA protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HLA-DMA proteins are key members of the MHC class II family and are essential for antigen presentation and immune response regulation. In this family, HLA-DMA is actively involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. HLA-DMA Protein, Human (His) is the recombinant human-derived HLA-DMA protein, expressed by E. coli , with N-His labeled tag.

Background

The HLA-DMA Protein is an essential member of the MHC class II family, playing a crucial role in antigen presentation and immune response regulation. As part of this family, HLA-DMA is involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. Recognized for its significance in the immune system, the HLA-DMA protein contributes to the activation of CD4+ T helper cells by presenting antigens derived from extracellular pathogens. Through its association with the MHC class II family, HLA-DMA underscores its integral role in facilitating adaptive immune responses and enhancing our understanding of immune system dynamics in health and disease.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q6ICR9 (V27-C233)

Gene ID
Molecular Construction
N-term
His
HLA-DMA (V27-C233)
Accession # Q6ICR9
C-term
Protein Length

Partial

Synonyms
HLA-DMA protein
AA Sequence

VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Predicted Molecular Mass
27.4 kDa
Molecular Weight

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HLA-DMA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HLA-DMA Protein, Human (His)
Cat. No.:
HY-P71463
Quantity:
MCE Japan Authorized Agent: