1. Recombinant Proteins
  2. Others
  3. Hemoglobin subunit theta-1/HBQ1 Protein, Human (His)

Hemoglobin subunit theta-1/HBQ1 Protein, Human (His)

Cat. No.: HY-P70272
Handling Instructions Technical Support

Hemoglobin subunit theta-1 (HBQ1) is a protein belonging to the globin family. Globulin is a group of proteins involved in oxygen transport and storage. Hemoglobin subunit theta-1/HBQ1 Protein, Human (His) is the recombinant human-derived Hemoglobin subunit theta-1/HBQ1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Hemoglobin subunit theta-1 (HBQ1) is a protein belonging to the globin family. Globulin is a group of proteins involved in oxygen transport and storage. Hemoglobin subunit theta-1/HBQ1 Protein, Human (His) is the recombinant human-derived Hemoglobin subunit theta-1/HBQ1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

Hemoglobin subunit theta-1 (HBQ1) is a protein that belongs to the globin family. Globins are a group of proteins involved in oxygen transport and storage. HBQ1 is one of the lesser-known members of the globin family, and its specific functions and roles are not well characterized. It is believed to be mainly expressed in the embryonic and fetal stages of development, suggesting a potential role in oxygen transport during early development. However, further research is needed to fully understand the exact functions and significance of HBQ1 in oxygen metabolism and its potential implications in health and disease.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P09105 (M1-R142)

Gene ID
Molecular Construction
N-term
6*His
HBQ1 (M1-R142)
Accession # P09105
C-term
Synonyms
rHuHemoglobin subunit theta-1, His; Hemoglobin subunit theta-1; Hemoglobin theta-1 chain; Theta-1-globin; HBQ1
AA Sequence

MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEYR

Molecular Weight

15 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Hemoglobin subunit theta-1/HBQ1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Hemoglobin subunit theta-1/HBQ1 Protein, Human (His)
Cat. No.:
HY-P70272
Quantity:
MCE Japan Authorized Agent: