1. Recombinant Proteins
  2. Others
  3. FLRT1 Protein, Human (HEK293, His)

FLRT1 is a key player in FGF-mediated signaling, activating MAP kinase and enhancing neurite outgrowth through FGFR1-mediated signaling.It helps increase the number and length of neurites. FLRT1 Protein, Human (HEK293, His) is the recombinant human-derived FLRT1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FLRT1 is a key player in FGF-mediated signaling, activating MAP kinase and enhancing neurite outgrowth through FGFR1-mediated signaling.It helps increase the number and length of neurites. FLRT1 Protein, Human (HEK293, His) is the recombinant human-derived FLRT1 protein, expressed by HEK293 , with C-His labeled tag.

Background

FLRT1 emerges as a key participant in fibroblast growth factor (FGF)-mediated signaling pathways, orchestrating the activation of MAP kinases. In the context of neurite outgrowth, FLRT1 plays a pivotal role by facilitating FGFR1-mediated activation of downstream MAP kinases, leading to a significant increase in both neurite number and length. Beyond its involvement in neural processes, FLRT1 is implicated in cell-cell adhesion and cell guidance through its interactions with ADGRL1/LPHN1 and ADGRL3. These interactions, particularly with FGFR1, ADGRL1/LPHN1, and ADGRL3, underscore FLRT1's versatility and its contribution to diverse cellular functions, ranging from neural development to cell adhesion and guidance.

Biological Activity

Immobilized Human FLRT1, His Tag at 0.5 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-FLRT1 Antibody, mFc Tag with the EC50 of 3.5 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q9NZU1 (I21-P524)

Gene ID
Molecular Construction
N-term
FLRT1 (I21-P524)
Accession # Q9NZU1
His
C-term
Protein Length

Partial

Synonyms
Leucine-Rich Repeat Transmembrane Protein FLRT1; Fibronectin-Like Domain-Containing Leucine-Rich Transmembrane Protein 1; FLRT1
AA Sequence

IDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLP

Molecular Weight

60-85 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FLRT1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FLRT1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70925
Quantity:
MCE Japan Authorized Agent: