1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. FKBP14 Protein, Human (HEK293, His)

The FKBP14 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that uniquely accelerates protein folding, particularly in protein synthesis. FKBP14 particularly favors 4-hydroxyproline-modified substrates, exhibits significant affinity for type III collagen, and has potential effects on type VI and type X collagen. FKBP14 Protein, Human (HEK293, His) is the recombinant human-derived FKBP14 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FKBP14 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that uniquely accelerates protein folding, particularly in protein synthesis. FKBP14 particularly favors 4-hydroxyproline-modified substrates, exhibits significant affinity for type III collagen, and has potential effects on type VI and type X collagen. FKBP14 Protein, Human (HEK293, His) is the recombinant human-derived FKBP14 protein, expressed by HEK293 , with C-His labeled tag.

Background

FKBP14 Protein emerges as a peptidyl-prolyl cis-trans isomerase (PPIase) with a distinctive role in expediting the folding of proteins, particularly during the intricate process of protein synthesis. Notably, FKBP14 exhibits a specific preference for substrates featuring 4-hydroxylproline modifications, with a pronounced affinity for type III collagen. Beyond its primary substrate, FKBP14 may also extend its catalytic activity to target type VI and type X collagens, suggesting a broader influence on the folding dynamics of diverse collagen types. The protein's ability to accelerate the folding of collagen molecules underscores its significance in modulating the structural integrity of these key extracellular matrix components, emphasizing FKBP14's potential impact on cellular and tissue physiology. Further exploration is warranted to elucidate the specific molecular mechanisms through which FKBP14 selectively acts on collagen substrates and to uncover its broader functional implications in protein folding processes.

Biological Activity

Measured by its ability to convert the substrate, Suc-AAPF-pNA, from Cis to Trans formation. The specific activity is 420.07 pmol/min/μg, as measured under the described conditions.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q9NWM8 (A20-K207)

Gene ID
Molecular Construction
N-term
FKBP14 (A20-K207)
Accession # Q9NWM8
His
C-term
Synonyms
Peptidyl-prolyl cis-trans isomerase FKBP14; 22 kDa FKBP; FKBP-22; FKBP-14
AA Sequence

ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYK

Molecular Weight

Approximately 25&27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FKBP14 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FKBP14 Protein, Human (HEK293, His)
Cat. No.:
HY-P76931
Quantity:
MCE Japan Authorized Agent: