1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. Fibroblast Growth Factor 21 (FGF-21)
  6. FGF-21 Protein, Human (181a.a)

FGF-21 Protein, Human (181a.a), Human is an atypical member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-21 Protein, Human (181a.a), Human is an atypical member of the fibroblast growth factor (FGF) subfamily, acts as a metabolic regulator with pleiotropic effects.

Background

Human Fibroblast Growth Factor 21 (FGF21) acts in an endocrine mannerand and is a metabolic regulator with pleiotropic effects. FGF21 possesses protective effects in the cardiovascular system, primarily due to metabolic effects other thanmaintaining energy homoeostasis. FGF21 is also involved inseveral processes, including reducing arteriosclerotic plaque formation in major vessels and protecting themyocardium from injuries caused by infarction, ischaemia-reperfusion, isoproterenol-induced hypertrophy anddiabetic lipotoxicity. In addition, FG2F1 induces these effects by atten-uating remodelling-related inflammation and oxidativestress and promoting myocardial energy metabolism, as well as by preventing lipid- or diabetes-induced cardiaccell apoptosis. FGF21 functions via its interaction with FGF receptors (FGFRs), with the assistance of the co-receptor β-Klotho. Structurally, the FGFRs are divided into four isoforms, FGFR1-FGFR4[1].

Biological Activity

Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤1.071 μg/ml in the presence of 1.25 μg/mL Recombinant Human Klotho beta.

  • Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.756 μg/mLin the presence of 1.25 μg/mL recombinant human Klotho beta, corresponding to a specific activity is 569.4761 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9NSA1 (H29-S209)

Gene ID
Molecular Construction
N-term
FGF-21 (H29-S209)
Accession # Q9NSA1
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuFGF-21; Fibroblast Growth Factor-21(FGF-21)
AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Molecular Weight

Approximately 23 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-21 Protein, Human (181a.a)
Cat. No.:
HY-P701092
Quantity:
MCE Japan Authorized Agent: