1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL21
  6. 6Ckine/CCL21B Protein, Mouse

6Ckine/CCL21B Protein, Mouse is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. Exodus-2/CCL21 Protein, Mouse  is a recombinant mouse 6Ckine/CCL21B (S24-G133) expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

6Ckine/CCL21B Protein, Mouse is a homeostatic lymphoid chemokine that contributes to the entry of T cells and dendritic cells into the lymphoid T-zone. It acts through chemokine receptors CCR7 and CXCR3 to promote fibrogenic and inflammatory cytokine production. Exodus-2/CCL21 Protein, Mouse  is a recombinant mouse 6Ckine/CCL21B (S24-G133) expressed by E. coli[1].

Background

CCL21, also known as exodus-2 and secondary lymphoid chemokine (SLC), is a small cytokine belonging to the CC chemokine family and is located on chromosome 9 in the human genome. It binds to glycosaminoglycan (GAG) and is anchored to the surface of endothelial cells. As a chemokine, CCL21 inhibits hematopoiesis and stimulates chemotaxis, and is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages or neutrophils. At the same time, CCL21 is a potent stimulator of T cell migration and adhesion, binding to the glycoprotein PSGL-1 on T cells to promote the migration of T cells to secondary lymphoid organs. CCL21 can act through chemokine receptors CCR7 and CXCR3. Among them, CCR7 is a GPCR that is normally expressed by T cell subsets central memory cells, thymic T cells, B cells, mature DCs and other rare cell subsets. ccl21 can function as a microglia activator in the CNS and is expressed exclusively in endangered or mechanically damaged neurons[1][2].

In Vitro

CCL21 (intrathecal administration, 0.06 μg/mouse, once, 14 days) results in a significant and instantaneous decrease in paw withdrawal threshold (PWT) to 0.93 g, which returns to the control value of 1.44 g within 48 hours in wild-type C57BL/6 mice, also causes a rapid decrease in PWT to 0.721 g and does not show any recovery throughout the experiment in paucity of lymphoid T cells (plt) mutation mice[2].
CCL21 (antibodies neutralization 10 μg/injection, twice weekly) reduces Pancreatic ductal adenocarcinoma (PDAC)-induced abdominal hypersensitivity, alleviates pain associated with pancreatic ductal adenocarcinoma and improves health status in situ mouse model of PDAC in C57BL/6 mice injected with K8484 cells[3].

In Vivo

CCL21(0-3 nM, 24 h) induces a rapid and significant upregulation of P2X4 protein expression of  microglia at concentrations as low as 1 nM[2].

Biological Activity

1.Full biological activity determined by a chemotaxis bioassay using murine T-lymphocytes is in a concentration range of 10-100 ng/mL.
2.Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7.The ED50 for this effect is 13.57 ng/mL, corresponding to a specific activity is 7.37×104 U/mg.

  • Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7 .The ED50 for this effect is 13.57 ng/mL, corresponding to a specific activity is 7.37×104 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P86792 (S24-G133)

Gene ID

65956

Molecular Construction
N-term
CC21B (S24-G133)
Accession # P86792
C-term
Protein Length

Full Length of Mature Protein

Synonyms
6Ckine; CCL21B; Beta-chemokine exodus-2;
AA Sequence

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Molecular Weight

Approximately 12.1-17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4-8.0, 150 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

6Ckine/CCL21B Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
6Ckine/CCL21B Protein, Mouse
Cat. No.:
HY-P7167
Quantity:
MCE Japan Authorized Agent: