1. Recombinant Proteins
  2. Others
  3. Cytochrome c/CYCS Protein, Human (His)

Cytochrome c/CYCS protein is a conserved heme-containing protein, and its core function is electron transport. Cytochrome c is widely involved in physiological processes such as aerobic/anaerobic respiration, apoptosis, and antioxidation. Cytochrome c/CYCS Protein, Human (His) is the recombinant Cytochrome c/CYCS protein expressed by E. coli and carries a C-terminal 6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Cytochrome c/CYCS Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cytochrome c/CYCS protein is a conserved heme-containing protein, and its core function is electron transport. Cytochrome c is widely involved in physiological processes such as aerobic/anaerobic respiration, apoptosis, and antioxidation. Cytochrome c/CYCS Protein, Human (His) is the recombinant Cytochrome c/CYCS protein expressed by E. coli and carries a C-terminal 6*His tag[1].

Background

Cytochrome c/CYCS protein, as a core component of the mitochondrial electron transport chain, is responsible for transferring electrons between cytochrome c reductase and oxidase, driving the oxidative phosphorylation process and ATP synthesis. In addition to its role in electron transport, Cytochrome c also plays a significant role in apoptosis. Upon stimulation by apoptotic signals, Cytochrome c is released from the mitochondrial intermembrane space into the cytoplasm, where it binds to APAF-1 to form an apoptosome, initiating the caspase cascade and inducing apoptosis. Furthermore, Cytochrome c is involved in the regulation of reactive oxygen species (ROS) metabolism, maintaining intracellular redox balance through antioxidant mechanisms. As a central molecule linking mitochondrial energy metabolism and apoptosis, Cytochrome c plays a critical role in various physiological and pathological processes[1].

In Vitro

Cytochrome c (10-20 μM; 0-150 min) can induce apoptosis in multiple cell types, such as normal rat renal epithelial cells, adrenocortical Y-1 tumor cells, mouse embryonic Swiss 3T3 fibroblasts, and IPC-81 leukemia cells[2].
Cytochrome c (5 μM; 3 min-15 h) increases K+ currents, and induces apoptosis and DNA fragmentation in rat pulmonary artery smooth muscle cells[3].

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P99999 (G2-E105)

Gene ID
Molecular Construction
N-term
CYCS (G2-E105)
Accession # P99999
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuCytochrome c/CYCS, His; Cytochrome C; CYCS; CYC
AA Sequence

GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Molecular Weight

Approximately 16.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 10% Trehalose, 200 mM NaCl, 50% Glycerol, 0.05% Tween 80, pH7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Cytochrome c/CYCS Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cytochrome c/CYCS Protein, Human (His)
Cat. No.:
HY-P70053
Quantity:
MCE Japan Authorized Agent: