1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors Cystatin Family
  4. Cystatin C
  5. Cystatin C/CST3 Protein, Mouse (HEK293, His)

Cystatin C (CST3), an inhibitor of cysteine proteinases, acts as a local regulator, playing a vital role in modulating proteolytic processes by inhibiting cysteine proteinases within specific cellular environments. Cystatin C/CST3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Cystatin C (CST3), an inhibitor of cysteine proteinases, acts as a local regulator, playing a vital role in modulating proteolytic processes by inhibiting cysteine proteinases within specific cellular environments. Cystatin C/CST3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Cystatin C (CST3), functioning as an inhibitor of cysteine proteinases, is believed to play a crucial physiological role as a local regulator of this enzyme activity. Its inhibitory function contributes to the regulation of cysteine proteinases, suggesting a role in modulating proteolytic processes within specific cellular environments.

Biological Activity

Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC and the IC50 value is < 25 nM. (Activation description: The proenzyme needs to be activated in reducing buffer for an activated form.)

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P21460 (M1-A140)

Gene ID
Molecular Construction
N-term
CST3 (M1-A140)
Accession # P21460
His
C-term
Protein Length

Full Length

Synonyms
Cystatin-C; Cystatin-3; Cst3
AA Sequence

MASPLRSLLFLLAVLAVAWAATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA

Molecular Weight

Approximately 15&18&21-24 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Cystatin C/CST3 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cystatin C/CST3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72966
Quantity:
MCE Japan Authorized Agent: