1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. I-TAC/CXCL11
  6. I-TAC/CXCL11 Protein, Mouse

The CXCL11 protein selectively attracts interleukin-activated T cells and induces calcium release in these cells. Its binding to CXCR3 suggests a complex role in T cell chemotaxis and may be important in CNS diseases involving T cell recruitment. I-TAC/CXCL11 Protein, Mouse is the recombinant mouse-derived CXCL11 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CXCL11 protein selectively attracts interleukin-activated T cells and induces calcium release in these cells. Its binding to CXCR3 suggests a complex role in T cell chemotaxis and may be important in CNS diseases involving T cell recruitment. I-TAC/CXCL11 Protein, Mouse is the recombinant mouse-derived CXCL11 protein, expressed by E. coli , with tag free.

Background

CXCL11 protein exhibits specific chemotactic activity for interleukin-activated T-cells but not for unstimulated T-cells, neutrophils, or monocytes. Its capacity to induce calcium release specifically in activated T-cells suggests a targeted role in the immune response. By binding to CXCR3, CXCL11 is intricately involved in T-cell chemotaxis, indicating its potential significance in diseases of the central nervous system that involve T-cell recruitment. Furthermore, CXCL11 may contribute to skin immune responses, as inferred by similarities in its function. The interaction of CXCL11 with TNFAIP6 via the Link domain suggests a regulatory role, emphasizing its involvement in modulating chemokine activity within complex cellular microenvironments.

Biological Activity

Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CXCR3. The ED50 for this effect is 5.904 ng/mL, corresponding to a specific activity is 1.694×105 U/mg.

  • Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CXCR3. The ED50 for this effect is 5.904 ng/mL, corresponding to a specific activity is 1.694×105 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q9JHH5 (F22-M100)

Gene ID
Molecular Construction
N-term
CXCL11 (F22-M100)
Accession # Q9JHH5
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Cxcl11; Scyb11C-X-C motif chemokine 11; Interferon-inducible T-cell alpha chemoattractant; I-TAC; Small-inducible cytokine B11
AA Sequence

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

Molecular Weight

Approximately 11 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

I-TAC/CXCL11 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
I-TAC/CXCL11 Protein, Mouse
Cat. No.:
HY-P71886
Quantity:
MCE Japan Authorized Agent: