1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL27
  6. CTACK/CCL27 Protein, Mouse

CTACK/CCL27 protein plays a crucial role in chemokine activity and cell chemotaxis. It regulates T cell chemotaxis and actin cytoskeletal reorganization, suggesting its involvement in immune responses and cell motility. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CTACK/CCL27 protein plays a crucial role in chemokine activity and cell chemotaxis. It regulates T cell chemotaxis and actin cytoskeletal reorganization, suggesting its involvement in immune responses and cell motility. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

Background

CTACK/CCL27 protein serves a vital role by enabling chemokine activity and participating in cell chemotaxis. It acts upstream of positive regulation of T cell chemotaxis and positive regulation of actin cytoskeleton reorganization, suggesting its involvement in immune responses and cellular motility. This protein is located in the extracellular region and nucleus, highlighting its versatility in cellular processes. With a broad expression pattern across various tissues, including the genitourinary system, hip, liver, sensory organ, and skeleton, CTACK/CCL27 exhibits a widespread impact on different physiological contexts. The orthologous relationship with human CCL27 emphasizes the evolutionary conservation and functional relevance of this chemokine protein across species.

Biological Activity

Measured by its ability to chemoattract HUT78 cells. The ED50 for this effect is 0.0145 μg/mL, corresponding to a specific activity is 6.897×104 U/mg.

  • Measured by its ability to chemoattract HUT78 cells. The ED50 for this effect is 0.0145 μg/mL, corresponding to a specific activity is 6.897×104 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

NP_035466 (L26-N120)

Gene ID
Molecular Construction
N-term
CCL27 (L26-N120)
Accession # NP_035466
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C-C motif chemokine 27; CC chemokine ILC; IL-11 R-alpha-locus chemokine; cutaneous T-cell-attracting chemokine; skinkine; skinskine; small inducible cytokine A27a; ALP; ILC; CTAK; CTACK; Ccl27; PESKY; ESkine; Scya27; Scya27a; AW558992
AA Sequence

LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN

Predicted Molecular Mass
10.9 kDa
Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CTACK/CCL27 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTACK/CCL27 Protein, Mouse
Cat. No.:
HY-P79264
Quantity:
MCE Japan Authorized Agent: