1. Recombinant Proteins
  2. Others
  3. CRMP1 Protein, Human

The CRMP1 protein is indispensable for class 3 semaphorin-mediated signaling that drives cytoskeletal remodeling critical for axonal guidance. CRMP1 downstream of SEMA3A induces FLNA dissociation from F-actin, promoting actin cytoskeleton reorganization and growth cone collapse. CRMP1 Protein, Human is the recombinant human-derived CRMP1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CRMP1 protein is indispensable for class 3 semaphorin-mediated signaling that drives cytoskeletal remodeling critical for axonal guidance. CRMP1 downstream of SEMA3A induces FLNA dissociation from F-actin, promoting actin cytoskeleton reorganization and growth cone collapse. CRMP1 Protein, Human is the recombinant human-derived CRMP1 protein, expressed by E. coli , with tag free.

Background

CRMP1 protein is essential for signaling mediated by class 3 semaphorins, playing a crucial role in the subsequent remodeling of the cytoskeleton. It actively participates in axon guidance, acting downstream of SEMA3A to induce the dissociation of FLNA from F-actin, leading to a reorganization of the actin cytoskeleton and the subsequent collapse of the growth cone. Beyond its role in axon guidance, CRMP1 is implicated in invasive growth and cell migration processes, suggesting its involvement in cellular dynamics. Additionally, there is evidence suggesting its potential contribution to cytokinesis. CRMP1 forms homotetramers and heterotetramers with DPYSL2, DPYSL3, DPYSL4, or DPYSL5, indicating its association with related proteins. Furthermore, it interacts with PLXNA1 and FLNA, specifically through FLNA's calponin-homology (CH) domain 1 and filamin repeat 24, altering FLNA's ternary structure and promoting its dissociation from F-actin, highlighting its intricate involvement in cytoskeletal dynamics.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q14194 (M1-G572)

Gene ID
Molecular Construction
N-term
CRMP1 (M1-G572)
Accession # Q14194
C-term
Protein Length

Full Length

Synonyms
Collapsin response mediator protein 1; CRMP 1; CRMP-1; Crmp1; Dihydropyrimidinase like 1; Dihydropyrimidinase related protein 1; Dihydropyrimidinase-related protein 1; DPYL1_HUMAN; DPYSL1; DRP 1; DRP-1; DRP1; ULIP-3; Ulip3; Unc-33-like phosphoprotein 3
AA Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

Molecular Weight

Approximately 62.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CRMP1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CRMP1 Protein, Human
Cat. No.:
HY-P71547
Quantity:
MCE Japan Authorized Agent: