1. Recombinant Proteins
  2. Receptor Proteins
  3. Claudin-3/CLDN3 Protein, Human (His-B2M)

Claudin-3/CLDN3 proteins play a critical role in tight junctions, eliminating intercellular spaces through calcium-independent cell adhesion activity. It exhibits multifunctionality by forming homo- and heteropolymers with other CLDN members, including CLDN1 and CLDN2. Claudin-3/CLDN3 Protein, Human (His-B2M) is the recombinant human-derived Claudin-3/CLDN3 protein, expressed by E. coli , with N-6*His, B2M labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Claudin-3/CLDN3 proteins play a critical role in tight junctions, eliminating intercellular spaces through calcium-independent cell adhesion activity. It exhibits multifunctionality by forming homo- and heteropolymers with other CLDN members, including CLDN1 and CLDN2. Claudin-3/CLDN3 Protein, Human (His-B2M) is the recombinant human-derived Claudin-3/CLDN3 protein, expressed by E. coli , with N-6*His, B2M labeled tag.

Background

Claudin-3/CLDN3 Protein assumes a crucial role in the specific obliteration of the intercellular space within tight junctions, employing calcium-independent cell-adhesion activity. This protein demonstrates its versatility by forming both homo- and heteropolymers with other CLDN members, including interactions with CLDN1 and CLDN2 homopolymers. Additionally, Claudin-3/CLDN3 directly engages with tight junction-associated proteins TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3, emphasizing its integral role in the assembly and maintenance of tight junction complexes. The ability to form polymers and interact with key junctional components highlights Claudin-3/CLDN3's significance in regulating cell adhesion and the structural integrity of intercellular spaces.

Species

Human

Source

E. coli

Tag

N-6*His;N-B2M

Accession

O15551 (R30-R80)

Gene ID
Molecular Construction
N-term
6*His-B2M
CLDN3 (R30-R80)
Accession # O15551
C-term
Protein Length

Extracellular Domain

Synonyms
C7orf1; Claudin-3; Claudin3; CLD3_HUMAN; CLDN 3; Cldn3; Clostridium perfringens enterotoxin receptor 2; CPE R2; CPE receptor 2; CPE-R 2; CPE-receptor 2; CPETR 2; CPETR2; HRVP 1; HRVP1; Rat ventral prostate 1 like protein; Rat ventral prostate.1 protein homolog; RVP1; Ventral prostate.1 like protein; Ventral prostate.1 protein homolog
AA Sequence

RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR

Molecular Weight

Predict MW: 20.2 kDa; Approximately 21 kDa, reducing conditions.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Claudin-3/CLDN3 Protein, Human (His-B2M) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Claudin-3/CLDN3 Protein, Human (His-B2M)
Cat. No.:
HY-P72146
Quantity:
MCE Japan Authorized Agent: