1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL6
  6. CCL6 Protein, Mouse

CCL6 Protein, Mouse is a CC chemokine found only in rodents and is associated with macrophage infiltration in chronic inflammation as well as a role in tumorigenesis. CCL6 Protein, Mouse is a recombinant mouse CCL6 (G22-A116) expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE CCL6 Protein, Mouse

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CCL6 Protein, Mouse is a CC chemokine found only in rodents and is associated with macrophage infiltration in chronic inflammation as well as a role in tumorigenesis. CCL6 Protein, Mouse is a recombinant mouse CCL6 (G22-A116) expressed by E. coli[1].

Background

CCL6, belongs to the CC family of chemokines is located in mouse chromosome 11. CCL6 can be expressed in cells of the neutrophil and macrophage lineage in mice and can be induced in large numbers under conditions suitable for bone marrow cell differentiation. C10/CCL6 shares significant homology with other chemokines, including human MIP-1γ, CC chemokine F-18 (CCF-18), hemofiltrate CC chemokine (HCC-1), and HCC-2[1]CCL6 is present in a variety of chronic inflammatory disorders including experimental demyelinating diseases, allergic airway inflammation, bleomycin-induced lung fibrosis and chronic peritonitis. CCL6 also can be used as a monocyte chemoattractant in a murine acute peritonitis[2].

In Vitro

CCL6 (100 -200 ng/mL) can cause concentration-dependent migration of murine ID8 cell lines and can induce migration through activation of ERK and PI3-kinase pathways, thereby enhancing downstream signaling through MYO9A and p-Cofilin[3].

Biological Activity

Full biological activity determined by a chemotaxis bioassay using human CCR1 transfected murine BaF3 cells is in a concentration range of 10-405 ng/ml.

  • Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CCR1. The ED50 for this effect is 404.9 ng/mL, corresponding to a specific activity is 2.470×103 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P27784 (G22-A116)

Gene ID

20305  [NCBI]

Molecular Construction
N-term
CCL6 (G22-A116)
Accession # P27784
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rMuCCL6; C-C motif chemokine 6; Scya6; C10
AA Sequence

GLIQEIEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA

Molecular Weight

Approximately 10.7 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CCL6 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL6 Protein, Mouse
Cat. No.:
HY-P7143
Quantity:
MCE Japan Authorized Agent: