1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL27
  6. CTACK/CCL27 Protein, Mouse

CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CTACK/CCL27 protein attracts skin-associated memory T-lymphocytes, mediating lymphocyte homing to the skin. It may also participate in embryonic cell migration. Nuclear forms of CCL27 induce cytoskeletal relaxation. The protein binds to CCR10, exists in monomeric, dimeric, and tetrameric forms, and heparin promotes oligomerization. Additionally, CCL27 interacts with TNFAIP6 through its Link domain. CTACK/CCL27 Protein, Mouse is the recombinant mouse-derived CTACK/CCL27 protein, expressed by E. coli , with tag free.

Background

CCL27 protein acts as a chemotactic factor specifically attracting skin-associated memory T-lymphocytes, potentially playing a crucial role in mediating the homing of lymphocytes to cutaneous sites. This chemokine may also participate in cell migration during embryogenesis. Notably, nuclear forms of CCL27 may contribute to cellular migration by inducing cytoskeletal relaxation. The protein binds to the CCR10 receptor and exists in monomeric, dimeric, and tetrameric forms, with heparin avidly promoting oligomerization. Furthermore, CCL27 interacts with TNFAIP6, specifically via its Link domain.

Biological Activity

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CCR10. The ED50 for this effect is 0.02838 μg/mL, corresponding to a specific activity is 3.524×104 U/mg.

  • Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with mouse CCR10. The ED50 for this effect is 0.02838 μg/mL, corresponding to a specific activity is 3.524×104 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q9Z1X0-1 (L26-N120)

Gene ID

100039863  [NCBI]

Molecular Construction
N-term
CCL27 (L26-N120)
Accession # NP_035466.1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Ccl27; Ilc; Scya27C-C motif chemokine 27; CC chemokine ILC; Cutaneous T-cell-attracting chemokine; CTACK; ESkine; IL-11 R-alpha-locus chemokine; ALP; mILC; Skinkine; Small-inducible cytokine A27
AA Sequence

LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSHPQQQN

Molecular Weight

Approximately 12 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CTACK/CCL27 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTACK/CCL27 Protein, Mouse
Cat. No.:
HY-P71894
Quantity:
MCE Japan Authorized Agent: