1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL25
  6. TECK/CCL25 Protein, Mouse

The CCL25 protein emerged as a potential coordinator of T cell development, suggesting its involvement in the complex process of T cell maturation. Its recombinant form exhibits chemotactic activity against various immune cell types, including thymocytes and macrophages, by binding to the chemokine receptor CCR9. TECK/CCL25 Protein, Mouse is the recombinant mouse-derived TECK/CCL25 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CCL25 protein emerged as a potential coordinator of T cell development, suggesting its involvement in the complex process of T cell maturation. Its recombinant form exhibits chemotactic activity against various immune cell types, including thymocytes and macrophages, by binding to the chemokine receptor CCR9. TECK/CCL25 Protein, Mouse is the recombinant mouse-derived TECK/CCL25 protein, expressed by E. coli , with tag free.

Background

CCL25 Protein emerges as a potential participant in T-cell development, suggesting a role in orchestrating the intricate processes associated with T-cell maturation. The recombinant form of CCL25 displays chemotactic activity on various immune cell types, including thymocytes, macrophages, THP-1 cells, and dendritic cells, while remaining inactive on peripheral blood lymphocytes and neutrophils. The protein exerts its effects by binding to the chemokine receptor CCR9, indicating its involvement in directing the migration of specific cell populations. Additionally, CCL25 binds to the atypical chemokine receptor ACKR4, facilitating the recruitment of beta-arrestin (ARRB1/2) to ACKR4. This diverse range of interactions underscores the potential regulatory role of CCL25 in immune cell trafficking and suggests its importance in the orchestration of immune responses and T-cell-related processes.

Biological Activity

Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR9 .The ED50 for this effect is 0.1269μg/mL, corresponding to a specific activity is 7880.221 U/mg.

  • Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR9 .The ED50 for this effect is 0.1269 μg/mL, corresponding to a specific activity is 7880.221 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

O35903 (Q24-N144)

Gene ID
Molecular Construction
N-term
CCL25 (Q24-N144)
Accession # O35903
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Ccl25; Scya25; Teck; C-C motif chemokine 25; Chemokine TECK; Small-inducible cytokine A25; Thymus-expressed chemokine
AA Sequence

QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN

Molecular Weight

Predict MW: 14.15 kDa; Approximately 16 kDa band in SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TECK/CCL25 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TECK/CCL25 Protein, Mouse
Cat. No.:
HY-P71893
Quantity:
MCE Japan Authorized Agent: