1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. Eotaxin-2/CCL24
  6. CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc)

CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc) is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse (HEK293,  Fc) is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by HEK293 with a hFc tag at the N-terminus.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc) is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse (HEK293,  Fc) is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by HEK293 with a hFc tag at the N-terminus[1].

Background

CCL24, also known as eosinophil chemotactic protein 2 (eotaxin-2) and myeloid progenitor inhibitory factor 2 (MPIF-2), is a small cytokine of the CC chemokine family, located on chromosome 7 in the human genome. CCL24 is highly chemotactic for resting T lymphocytes and eosinophils and has low chemotactic activity for neutrophils, but not for monocytes and activated lymphocytes. By binding to its sole receptor CCR3, of which CCR3, is present mainly on eosinophils, but also on basophils, monocytes, Th2 lymphocytes, epithelial cells and airway smooth muscle. CCL24 mainly mediates atopic diseases, parasitic infections and systemic diseases, but also promotes cellular transport and regulates inflammatory and fibrotic activities[1][2].

In Vivo

CCL24 deficiency leads to reduced dermal thickness and infiltration of immune cells into the bronchoalveolar lavage (BAL) fluid and significantly reduced α-SMA expression in a mouse model of bleomycin (BLM)-induced skin fibrosis[3].

Biological Activity

Measured by its ability to chemoattract BaF3 mouse proB cells transfected with mouse CCR3. The ED50 for this effect is 2.001 ng/mL, corresponding to a specific activity is 4.998×105 U/mg.

  • Measured by its ability to chemoattract BaF3 mouse proB cells transfected with mouse CCR3. The ED50 for this effect is 2.001 ng/mL, corresponding to a specific activity is 4.998×105 U/mg.
Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q9JKC0 (V27-V119)

Gene ID
Molecular Construction
N-term
hFc
CCL24 (V27-V119)
Accession # Q9JKC0
C-term
Protein Length

Full Length of Mature Protein

Synonyms
CK-beta-6; Eotaxin-2; MPIF-2; MPIF2; SCYA24; Ckb-6; CCL24; member 24; CK-β-6
AA Sequence

VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV

Molecular Weight

40-50 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL24/Eotaxin-2 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P78250
Quantity:
MCE Japan Authorized Agent: