1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL21
  6. CCL21C Protein, Mouse

CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.

Background

CCL21C protein exerts dual functions by inhibiting hemopoiesis and inducing chemotaxis. In vitro, it demonstrates chemotactic activity specifically for thymocytes and activated T-cells, with no significant effect on B-cells, macrophages, or neutrophils. Additionally, CCL21C acts as a potent chemoattractant for mesangial cells and exhibits preferential activity towards naive T-cells. Implicating a role in lymphocyte homing to secondary lymphoid organs, CCL21C binds to both CCR7 and CXCR3 receptors. Furthermore, it interacts with PDPN, leading to the relocalization of PDPN to the basolateral membrane. These findings underscore the diverse regulatory functions of CCL21C in immune cell behavior and tissue-specific responses.

Biological Activity

Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7 .The ED50 for this effect is 37.24 ng/mL, corresponding to a specific activity is 2.69×10^4 U/mg.

  • Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7 .The ED50 for this effect is 37.24 ng/mL, corresponding to a specific activity is 2.69×10^4 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P86793 (S24-G133)

Gene ID

100042493  [NCBI]

Molecular Construction
N-term
CCL21C (S24-G133)
Accession # P86793
C-term
Synonyms
Ccl21c; Scya21cC-C motif chemokine 21c; 6Ckine; Beta-chemokine exodus-2; Small-inducible cytokine A21c; Thymus-derived chemotactic agent 4; TCA4
AA Sequence

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Molecular Weight

Approximately 18 kDa band in SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CCL21C Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL21C Protein, Mouse
Cat. No.:
HY-P71892
Quantity:
MCE Japan Authorized Agent: