CCL21C Protein, Mouse

CCL21C protein has dual functions of inhibiting hematopoiesis and inducing chemotaxis. In vitro, it selectively attracts thymocytes and activated T cells without affecting B cells, macrophages or neutrophils. CCL21C Protein, Mouse is the recombinant mouse-derived CCL21C protein, expressed by E. coli , with tag free.

CCL21C protein exerts dual functions by inhibiting hemopoiesis and inducing chemotaxis. In vitro, it demonstrates chemotactic activity specifically for thymocytes and activated T-cells, with no significant effect on B-cells, macrophages, or neutrophils. Additionally, CCL21C acts as a potent chemoattractant for mesangial cells and exhibits preferential activity towards naive T-cells. Implicating a role in lymphocyte homing to secondary lymphoid organs, CCL21C binds to both CCR7 and CXCR3 receptors. Furthermore, it interacts with PDPN, leading to the relocalization of PDPN to the basolateral membrane. These findings underscore the diverse regulatory functions of CCL21C in immune cell behavior and tissue-specific responses.

Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human CCR7 .The ED₅₀ for this effect is 37.24 ng/mL, corresponding to a specific activity is 2.69×10^4 U/mg.

Mouse

E. coli

Tag Free

P86793 (S24-G133)

100042493  [NCBI]

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Approximately 18 kDa band in SDS-PAGE under reducing conditions.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.