1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL17
  6. TARC/CCL17 Protein, Rat (His)

CCL17 protein is a chemokine with selective chemotactic activity towards Th2 cells and plays a crucial role in various inflammatory and immune processes. It coordinates immune responses by binding to CCR4 on the surface of T cells. TARC/CCL17 Protein, Rat (His) is the recombinant rat-derived TARC/CCL17 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CCL17 protein is a chemokine with selective chemotactic activity towards Th2 cells and plays a crucial role in various inflammatory and immune processes. It coordinates immune responses by binding to CCR4 on the surface of T cells. TARC/CCL17 Protein, Rat (His) is the recombinant rat-derived TARC/CCL17 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The CCL17 protein functions as a chemokine, demonstrating chemotactic activity for T lymphocytes, particularly favoring Th2 cells over monocytes or granulocytes. This specificity underscores its crucial role in a diverse array of inflammatory and immunological processes. Operating through the binding to CCR4 on the T-cell surface, CCL17 actively participates in orchestrating immune responses. Additionally, CCL17 plays a role in mediating GM-CSF/CSF2-driven pain and inflammation, and in the brain, it is indispensable for maintaining the typical highly branched morphology of hippocampal microglia under homeostatic conditions. Moreover, CCL17 may be pivotal for the appropriate adaptation of microglial morphology and synaptic plasticity in response to acute lipopolysaccharide (LPS)-induced neuroinflammation. Furthermore, CCL17 contributes to wound healing by inducing fibroblast migration into the wound, further highlighting its multifaceted involvement in immune regulation and tissue repair processes.

Biological Activity

1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/mL.
2.Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is approximately 0.6155 ng/mL, corresponding to a specific activity is 1.62×106 U/mg.

  • Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is approximately 0.6155 ng/mL, corresponding to a specific activity is 1.62×106 U/mg.
Species

Rat

Source

E. coli

Tag

N-6*His

Accession

Q9ERE0 (A24-L93)

Gene ID
Molecular Construction
N-term
6*His
CCL17 (A24-L93)
Accession # Q9ERE0
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C-C motif chemokine; CCL17
AA Sequence

ARATNVGRECCLDYFKGAIPIRKLVTWFRTSVECPKDAIVFETVQGRLICTDPKDKHVKKAIRHLKNQRL

Predicted Molecular Mass
8.1 kDa
Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is approximately 0.6155 ng/mL, corresponding to a specific activity is 1.62×106 U/mg.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm solution of PBS, pH 7.4 or 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TARC/CCL17 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TARC/CCL17 Protein, Rat (His)
Cat. No.:
HY-P71902
Quantity:
MCE Japan Authorized Agent: