1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. Eotaxin/CCL11
  6. CCL11 Protein, Rhesus macaque (N-His)

The CCL11 protein directly promotes eosinophil accumulation in response to allergens, a key feature of allergic inflammation, without significantly affecting lymphocytes, macrophages, or neutrophils. This selective recruitment highlights the specificity of CCL11 in the coordination of immune responses, particularly in allergy. CCL11 Protein, Rhesus macaque (N-His) is the recombinant Rhesus Macaque-derived CCL11 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CCL11 protein directly promotes eosinophil accumulation in response to allergens, a key feature of allergic inflammation, without significantly affecting lymphocytes, macrophages, or neutrophils. This selective recruitment highlights the specificity of CCL11 in the coordination of immune responses, particularly in allergy. CCL11 Protein, Rhesus macaque (N-His) is the recombinant Rhesus Macaque-derived CCL11 protein, expressed by E. coli , with N-6*His labeled tag.

Background

In response to the presence of allergens, the CCL11 protein plays a direct role in promoting the accumulation of eosinophils, which is a prominent characteristic of allergic inflammatory reactions, while showing no significant effect on lymphocytes, macrophages, or neutrophils. This selective recruitment underscores CCL11's specificity in orchestrating immune responses, particularly in the context of allergic reactions. The protein achieves this effect by binding to CCR3, emphasizing its engagement with specific receptors to regulate the migration and activation of eosinophils in response to allergenic stimuli.

Biological Activity

Measured in a cell proliferation assay using HUVEC cells.The ED50 for this effect is 2.326 ng/mL, corresponding to a specific activity is 4.30×105 units/mg.

  • Measured in a cell proliferation assay using HUVEC cells.The ED50 for this effect is 2.326 ng/mL, corresponding to a specific activity is 4.30×105 units/mg.
Species

Rhesus Macaque

Source

E. coli

Tag

N-6*His

Accession

Q8MIT7 (G24-P97)

Gene ID
Molecular Construction
N-term
6*His
CCL11 (G24-P97)
Accession # Q8MIT7
C-term
Protein Length

Full Length of Mature Protein

Synonyms
CCL11; SCYA11Eotaxin; C-C motif chemokine 11; Small-inducible cytokine A11
AA Sequence

GPDSVATTCCFTLTNKKIPLQRLESYRRIISGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDRKSPTPKP

Predicted Molecular Mass
8.4 kDa
Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CCL11 Protein, Rhesus macaque (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CCL11 Protein, Rhesus macaque (N-His)
Cat. No.:
HY-P700285
Quantity:
MCE Japan Authorized Agent: