1. Recombinant Proteins
  2. Others
  3. BD-1 Protein, Human

BD-1 Protein, Human is an antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BD-1 Protein, Human is an antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.

Background

Recombinant Human Beta Defensin-1 is an antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts[1]. Human Beta Defensin-1 may provide a fast-acting antimicrobial coating of tubular lumens in the upper urinary tract to prevent infection by inhibiting bacterial attachment to the urothelium and serving as a second-line chemical shield[2].

Biological Activity

Full biological activity determined by a chemotaxis bioassay using CD34+ dendritic cells is in a concentration range of 100-1000 ng/mL.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P60022 (G22-K68)

Gene ID
Molecular Construction
N-term
BD-1 (G22-K68)
Accession # P60022
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuBD-1; HBD1; DEFB1
AA Sequence

GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

Molecular Weight

Approximately 5.1 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PBS, pH 7.4, 130 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

BD-1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BD-1 Protein, Human
Cat. No.:
HY-P7133
Quantity:
MCE Japan Authorized Agent: