1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MCP-1/CCL2
  6. Animal-Free MCP-1/CCL2 Protein, Mouse (His)

The MCP-1/CCL2 protein, as a CCR2 ligand, induces potent chemotactic responses and intracellular calcium mobilization in monocytes and basophils, without affecting neutrophils or eosinophils.It is critical for neuropathic pain and enhances NMDA-mediated synaptic transmission in neurons containing dopamine D1 and D2 receptors, possibly involving MAPK/ERK-dependent GRIN2B/NMDAR2B phosphorylation.Animal-Free MCP-1/CCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMCP-1/CCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MCP-1/CCL2 protein, as a CCR2 ligand, induces potent chemotactic responses and intracellular calcium mobilization in monocytes and basophils, without affecting neutrophils or eosinophils.It is critical for neuropathic pain and enhances NMDA-mediated synaptic transmission in neurons containing dopamine D1 and D2 receptors, possibly involving MAPK/ERK-dependent GRIN2B/NMDAR2B phosphorylation.Animal-Free MCP-1/CCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMCP-1/CCL2 protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

Background

MCP-1/CCL2 protein acts as a ligand for C-C chemokine receptor CCR2, initiating a robust chemotactic response and intracellular calcium mobilization through CCR2 binding and activation. It demonstrates chemotactic activity for monocytes and basophils while not affecting neutrophils or eosinophils. Playing a pivotal role in mediating peripheral nerve injury-induced neuropathic pain, MCP-1/CCL2 also enhances NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, potentially involving MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. Existing as a monomer or homodimer in equilibrium, it is tethered to endothelial cells by glycosaminoglycan (GAG) side chains of proteoglycans and interacts with TNFAIP6 through its Link domain.

Biological Activity

Measure by its ability to chemoattract BaF3 cells transfected with CCR2A. The ED50 for this effect is <8 ng/mL.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P10148 (Q24-N148)

Gene ID
Molecular Construction
N-term
6*His
CCL2 (Q24-N148)
Accession # P10148
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Monocyte Chemotactic Protein-1; MCP-1; JE
AA Sequence

QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

Predicted Molecular Mass
14.7 kDa
Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free MCP-1/CCL2 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free MCP-1/CCL2 Protein, Mouse (His)
Cat. No.:
HY-P700164AF
Quantity:
MCE Japan Authorized Agent: