1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36 gamma
  6. Animal-Free IL-36 gamma/IL-1F9 Protein, Human (His)

Animal-Free IL-36 gamma/IL-1F9 Protein, Human (His)

Cat. No.: HY-P75861AF
Handling Instructions Technical Support

IL-36 gamma/IL-1F9 protein activates the NF-kappa-B and MAPK pathways, induces the expression of various chemokines and pro-inflammatory factors, and promotes local inflammatory responses in the epithelial barrier. It affects keratinocytes, dendritic cells, and T cells, driving tissue infiltration, maturation, and proliferation. Animal-Free IL-36 gamma/IL-1F9 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 gamma/IL-1F9 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-36 gamma/IL-1F9 protein activates the NF-kappa-B and MAPK pathways, induces the expression of various chemokines and pro-inflammatory factors, and promotes local inflammatory responses in the epithelial barrier. It affects keratinocytes, dendritic cells, and T cells, driving tissue infiltration, maturation, and proliferation. Animal-Free IL-36 gamma/IL-1F9 Protein, Human (His) is the recombinant human-derived animal-FreeIL-36 gamma/IL-1F9 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-36 gamma/IL-1F9 protein, a cytokine, binds to and signals through the IL1RL2/IL-36R receptor, activating NF-kappa-B and MAPK signaling pathways in target cells, thereby contributing to a pro-inflammatory response. As a vital component of the IL-36 signaling system believed to be present in epithelial barriers, IL-36 gamma shares similarities with the IL-1 system and utilizes the coreceptor IL1RAP. It appears to be integral to skin inflammatory responses, exerting influence on keratinocytes, dendritic cells, and indirectly impacting T-cells, thereby driving tissue infiltration, cell maturation, and proliferation. In cultured keratinocytes, IL-36 gamma induces the expression of various chemokines, including CCL3, CCL4, CCL5, CCL2, CCL17, CCL22, CL20, CCL5, CCL2, CCL17, CCL22, CXCL8, CCL20, and CXCL1. Additionally, IL-36 gamma stimulates its own expression and that of prototypic cutaneous pro-inflammatory parameters such as TNF-alpha, S100A7/psoriasin, and inducible NOS. It may play a role in pro-inflammatory responses during specific neutrophilic airway inflammation, activating mitogen-activated protein kinases and NF-kappa B in primary lung fibroblasts and stimulating the expression of IL-8, CXCL3, and Th17 chemokine CCL20 in lung fibroblasts. IL-36 gamma might also be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. Interacting with the cargo receptor TMED10, IL-36 gamma undergoes translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC), facilitating secretion.

Biological Activity

Measure by its ability to induce IL-8 secretion in A431 cells. The ED50 for this effect is <5 ng/mL.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9NZH8-1 (S18-D169)

Gene ID
Molecular Construction
N-term
IL-36γ (S18-D169)
Accession # Q9NZH8-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
IL-36 gamma; IL-36γ; Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1RP2; IL-1 epsilon; IL-1F9; Interleukin-1 homolog 1; IL-1H1
AA Sequence

MSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Predicted Molecular Mass
18 kDa
Molecular Weight

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-36 gamma/IL-1F9 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-36 gamma/IL-1F9 Protein, Human (His)
Cat. No.:
HY-P75861AF
Quantity:
MCE Japan Authorized Agent: