1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-13
  5. Animal-Free IL-13 Protein, Human (His)

IL-13 Protein is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. Animal-Free IL-13 Protein, Human (His) is the recombinant human-derived animal-FreeIL-13 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-13 Protein is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and elicits B cell proliferation. Animal-Free IL-13 Protein, Human (His) is the recombinant human-derived animal-FreeIL-13 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

Interleukin-13 (IL-13) is a cytokine which is secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. IL-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. The circular dichroism spectrum confirms that interleukin-13 belongs to the alpha-helical family of cytokines. IL-13 synergizes with IL2 in regulating interferon-gamma synthesis. IL-13 exerts its biological effects through the IL4R chain and the IL13RA1 chain, to activate JAK1, TYK2 and STAT6. IL-13 affects the morphology, growth, and surface antigen expression and phenotype of monocytes and stimulates B-cell proliferation, and activation of eosinophils, basophils, and mast cells. In human macrophages and monocytes, hIL-13 has been shown to inhibit HIV replication. Human IL-13 also inhibits proinflammatory cyto-kines induced by LPS exposure, indicating poten-tial therapeutic applicationsas an anti-inflammatory agent[1][2][3][4][5][6].

Biological Activity

Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is<0.8 ng/mL. The specific activity of recombinant human IL- 13 is approximately >1 x106 IU/ mg

Species

Human

Source

E. coli

Tag

C-His

Accession

P35225 (G35-N146)

Gene ID
Molecular Construction
N-term
IL-13 (G35-N146)
Accession # P35225
His
C-term
Protein Length

Partial

Synonyms
NC30
AA Sequence

MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Molecular Weight

Approximately 13.28 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-13 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-13 Protein, Human (His)
Cat. No.:
HY-P700102AF
Quantity:
MCE Japan Authorized Agent: