1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Adenylate Kinase 1/AK1 Protein, Rat (His)

The adenylate kinase 1 (AK1) protein plays a crucial role in cellular energy homeostasis by maintaining the balance of adenylate nucleotides by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP.Adenylate Kinase 1/AK1 Protein, Rat (His) is the recombinant rat-derived Adenylate Kinase 1/AK1 protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The adenylate kinase 1 (AK1) protein plays a crucial role in cellular energy homeostasis by maintaining the balance of adenylate nucleotides by catalyzing the reversible transfer of terminal phosphate groups between ATP and AMP.Adenylate Kinase 1/AK1 Protein, Rat (His) is the recombinant rat-derived Adenylate Kinase 1/AK1 protein, expressed by E.coli , with N-His labeled tag.

Background

Adenylate Kinase 1 (AK1) is a versatile enzyme that catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP, a critical step in cellular energy homeostasis. Additionally, AK1 exhibits nucleoside diphosphate kinase activity, facilitating the production of various nucleoside triphosphates (ATP, CTP, GTP, UTP, dATP, dCTP, dGTP, and dTTP) from their corresponding diphosphate substrates, using either ATP or GTP as a phosphate donor. This enzymatic flexibility highlights its essential role in nucleotide biosynthesis. Furthermore, AK1 demonstrates a lower-rate catalysis of the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP, indicating its involvement in thiamine metabolism. The multifaceted functions of AK1 underscore its importance in maintaining cellular energy levels and participating in diverse nucleotide and cofactor biosynthetic pathways.

Biological Activity

Specific activity is 933.598 units/mg. One unit will convert ATP + AMP to 2.0 µmoles of ADP per minute at pH 7.5 at 37 °C.

Species

Rat

Source

E. coli

Tag

N-6*His

Accession

P39069 (M1-K194)

Gene ID
Molecular Construction
N-term
His
AK1 (M1-K194)
Accession # P39069
C-term
Protein Length

Full Length

Synonyms
Adenylate kinase isoenzyme 1; ATP-AMP transphosphorylase 1; AK1
AA Sequence

MEDKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSSRGKMLSSIMEKGELVPLETVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVISFYDKRGIVRKVNAEGSVDTVFSQVCTYLDSLK

Molecular Weight

Approximately 23 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 100 mM arginine, pH 7.1, 20% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Adenylate Kinase 1/AK1 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adenylate Kinase 1/AK1 Protein, Rat (His)
Cat. No.:
HY-P74427
Quantity:
MCE Japan Authorized Agent: