1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. Adenylate Kinase 1/AK1 Protein, Human (His)

Adenylate Kinase 1/AK1 Protein is an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. AK1 is highly expressed in skeletal muscle, brain and erythrocytes. It facilitates cellular energy dynamics by catalyzing the reversible transfer of the terminal phosphate group between ATP and AMP. In addition, AK1 displays nucleoside diphosphate kinase activity. Adenylate Kinase 1/AK1 Protein, Human (His) is the recombinant human-derived Adenylate Kinase 1/AK1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Adenylate Kinase 1/AK1 Protein is an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. AK1 is highly expressed in skeletal muscle, brain and erythrocytes. It facilitates cellular energy dynamics by catalyzing the reversible transfer of the terminal phosphate group between ATP and AMP. In addition, AK1 displays nucleoside diphosphate kinase activity. Adenylate Kinase 1/AK1 Protein, Human (His) is the recombinant human-derived Adenylate Kinase 1/AK1 protein, expressed by E. coli , with N-His labeled tag.

Background

Adenylate Kinase 1/AK1 is an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. AK1 is highly expressed in skeletal muscle, brain and erythrocytes. It facilitates cellular energy dynamics by catalyzing the reversible transfer of the terminal phosphate group between ATP and AMP. In addition to its primary role, AK1 displays nucleoside diphosphate kinase activity, enabling the production of ATP, CTP, GTP, UTP, dATP, dCTP, dGTP, and dTTP from their corresponding diphosphate substrates, utilizing either ATP or GTP as the phosphate donor. Furthermore, AK1 exhibits a low-rate catalysis for the synthesis of thiamine triphosphate (ThTP) from thiamine diphosphate (ThDP) and ADP. The multifunctional enzymatic activities of AK1 underscore its significance in maintaining adenylate nucleotide balance and its potential role in broader cellular processes, extending beyond traditional nucleotide metabolism[1][2].

Biological Activity

Specific activity is 120.42 pmol/min/μg. One unit will convert 1 pmoles of AMP and ATP to 2 pmoles of ADP per minute at 37°C.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH01116 (M1-K194)

Gene ID

203  [NCBI]

Molecular Construction
N-term
His
AK1 (M1-K194)
Accession # AAH01116
C-term
Synonyms
Adenylate kinase isoenzyme 1; ATP-AMP transphosphorylase 1; AK1
AA Sequence

MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Molecular Weight

Approximately 23 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, 10% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Adenylate Kinase 1/AK1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adenylate Kinase 1/AK1 Protein, Human (His)
Cat. No.:
HY-P74428
Quantity:
MCE Japan Authorized Agent: