1. Peptides
  2. Peptide and Derivatives
  3. Peptides for Drug Delivery
  4. Responsive Peptides
  5. pH-Low Insertion Peptide TFA

pH-Low Insertion Peptide TFA  (Synonyms: pHLIP TFA)

Cat. No.: HY-P4116A Purity: 95.17%
Handling Instructions Technical Support

pH-Low Insertion Peptide TFA (pHLIP TFA) is a short, pH-responsive peptide capable of inserting across a cell membrane to form a transmembrane helix at acidic pH. pH-Low Insertion Peptide TFA targets the acidic tumor microenvironment for tumors at early and metastatic stages with high specificity, used as a specific ligand. pH-Low Insertion Peptide TFA successfully modifys polylysine polymers to have the pH-responsive capability. pH-Low Insertion Peptide TFA -based targeting of cancer presents an opportunity to monitor metabolic changes and to selectively deliver imaging and therapeutic agents to tumors.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

pH-Low Insertion Peptide TFA Chemical Structure

pH-Low Insertion Peptide TFA Chemical Structure

Size Price Stock Quantity
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of pH-Low Insertion Peptide TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

pH-Low Insertion Peptide TFA (pHLIP TFA) is a short, pH-responsive peptide capable of inserting across a cell membrane to form a transmembrane helix at acidic pH. pH-Low Insertion Peptide TFA targets the acidic tumor microenvironment for tumors at early and metastatic stages with high specificity, used as a specific ligand. pH-Low Insertion Peptide TFA successfully modifys polylysine polymers to have the pH-responsive capability. pH-Low Insertion Peptide TFA -based targeting of cancer presents an opportunity to monitor metabolic changes and to selectively deliver imaging and therapeutic agents to tumors[1][2][3].

In Vitro

pH-Low Insertion Peptide TFA (5 μM, 2 h) combined with peptide nucleic acid (peptide nucleic acid, PNA) significantly increases PNA delivery at pH 6.2 in A549 cells[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Immunofluorescence[3]

Cell Line: A549 cells
Concentration: 5 μM
Incubation Time: 2 h
Result: Significantly increases PNA delivery combined with PNA at pH 6.2 in A549 cells.
In Vivo

pH-Low Insertion Peptide TFA (50 μM, a single tail vein injection, 4, 24, and 48 h) variants shows the pH-dependent tumor targeting and different blood clearance profiles, the overall tumor spatial distributions are identical in murine 4T1 xenograft mode[2].
pH-Low Insertion Peptide TFA (10 μM, i.v., a single dose for 24 h) can clearly differentiate between regions of primarily tumor cells and nonmalignant stromal tissues, also accumulates the hypoxia marker Pimonidazole (HY-105129A) and relates to the production of acidic glucose metabolites in MMTV-Py MT mice[2].
pH-Low Insertion Peptide TFA (0.2 μmol/kg, i.v., a single dose for 24 h) demonstrats excellent tumor targeting combined with PNA in mice seeded melanoma tumors[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Murine 4T1 xenograft model[2]
Dosage: 50 μM
Administration: a single tail vein injection, tumors collected at 4, 24, and 48 h after administration
Result: The spatial distribution and the intensity profiles of all pHLIP TFAs in tumors were identical in murine 4T1 xenograft mode.
Animal Model: FVB/N-Tg(MMTV-PyVT)634Mul/J transgenic female mice developed palpable mammary tumors at 12-15 weeks of age[2]
Dosage: 10 μM
Administration: i.v., a single dose for 24 h
Result: Clearly differentiated between regions of primarily tumor cells and nonmalignant stromal tissues.
Animal Model: 6-week old C57BL/6 mice seeded melanoma tumors[3]
Dosage: 0.2 μmol/kg
Administration: intravenously injected via the retro-orbital sinus, a single dose for 24 h
Result: All the pH-Low Insertion Peptide TFA-PNAs demonstrated excellent tumor targeting.
Molecular Weight

4054.57 (free base)

Formula

C189H282N42O55S.xC2HF3O2

Appearance

Solid

Color

White to off-white

Sequence

Ala-Cys-Glu-Gln-Asn-Pro-Ile-Tyr-Trp-Ala-Arg-Tyr-Ala-Asp-Trp-Leu-Phe-Thr-Thr-Pro-Leu-Leu-Leu-Leu-Asp-Leu-Ala-Leu-Leu-Val-Asp-Ala-Asp-Glu-Thr

Sequence Shortening

ACEQNPIYWARYADWLFTTPLLLLDLALLVDADET

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Purity & Documentation

Purity: 96.37%

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
pH-Low Insertion Peptide TFA
Cat. No.:
HY-P4116A
Quantity:
MCE Japan Authorized Agent: