1. GPCR/G Protein
  2. GnRH Receptor
  3. Kisspeptin-54(human)

Kisspeptin-54(human)  (Synonyms: Metastin(human))

Cat. No.: HY-P1022 Purity: 98.00%
Handling Instructions Technical Support

Kisspeptin-54(human) (Metastin(human)) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) inhibits tumor metastasis and stimulates the secretion of gonadotropin (LH) and testosterone.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Kisspeptin-54(human) Chemical Structure

Kisspeptin-54(human) Chemical Structure

CAS No. : 374683-24-6

Size Price Stock Quantity
100 μg In-stock
500 μg In-stock
1 mg In-stock
5 mg   Get quote  
10 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Kisspeptin-54(human):

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Kisspeptin-54(human)

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Kisspeptin-54(human) (Metastin(human)) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) inhibits tumor metastasis and stimulates the secretion of gonadotropin (LH) and testosterone[1][2][3][4][5][6][7][8].

IC50 & Target

Ki: 1.81 nM (Rat GPR54) and 1.45 nM (Human GPR54)[2]

In Vitro

Kisspeptin-54(human) (1-100 nM, 4-48 h) stimulates aldosterone synthesis in human adrenal cells (H295R cells and fetal adrenal neocortex cells)[3].
Kisspeptin-54(human) (1-10 μM, 12 h) suppresses migration of human pancreatic cancer cells (PANC-1) [4].
Kisspeptin-54(human) (10-1000 nM, 14-16 h for migration, 24-48 h for invasion) inhibits migration and invasion of human renal cell carcinoma cells (Caki-1 and ACHN) with overexpression of metastireceptor[5].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Migration Assay [4]

Cell Line: PANC-1, AsPC-1
Concentration: 0.1, 1, and 10 μM
Incubation Time: 12 h
Result: Did not significantly affect the migration of AsPC-1.
Inhibited migration of PANC-1 at 1 and 10 μM.

Cell Invasion Assay[4]

Cell Line: PANC-1, AsPC-1
Concentration: 0.1, 1, and 10 μM
Incubation Time: 12 h
Result: Did not significantly affect the invasion of the two cell lines.
In Vivo

Kisspeptin-54(human) (0.3-100 nmol/kg, i.p., 30 min before trunk blood and anterior pituitaries are collected) dose-dependently shows activation of the anterior pituitary release of LH in post-pubertal male rats[6].
Kisspeptin-54(human) (0.3-30 nmol/kg, i.p.) produces a dose-dependent effect on c-fos mRNA levels in the anterior pituitary in various ages (PND15, PND30, and PND45) male rats[6].
Kisspeptin-54(human) (0.1-30 nmol/kg, i.p., single) increases serum testosterone in mice, with the same potency as for mouse kisspeptins[7].
Kisspeptin-54(human) (6.7 nmol/rat, s.c.) induces the release of gonadotropin via activation of the hypothalamic GnRH neurons in prepubertal female rats[8].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Post-pubertal male rats[6]
Dosage: 0.3, 1.0, 3.0, 10, 30 and 100 nmol/kg
Administration: Intraperitoneal injection (i.p.), 30 min before trunk blood and anterior pituitaries are collected
Result: Elevated c-fos gene expression, as well as the plasma concentrations of LH and testosterone.
Showed no overall statistical effect on plasma testosterone.
Molecular Weight

5857.43

Synonyms

Metastin(human)

Formula

C258H401N79O78

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2

Sequence Shortening

GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvent & Solubility
In Vitro: 

H2O : 50 mg/mL (8.54 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1707 mL 0.8536 mL 1.7072 mL
5 mM 0.0341 mL 0.1707 mL 0.3414 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation

Purity: 98.00%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.1707 mL 0.8536 mL 1.7072 mL 4.2681 mL
5 mM 0.0341 mL 0.1707 mL 0.3414 mL 0.8536 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kisspeptin-54(human)
Cat. No.:
HY-P1022
Quantity:
MCE Japan Authorized Agent: