2. Signaling Pathways
  3. Anti-infection
  4. Bacterial

Bacterial

Bacterial

Related Products

PDF 14.26 MB

Anything that destroys bacteria or suppresses their growth or their ability to reproduce. Heat, chemicals such as chlorine, and antibiotic drugs all have antibacterial properties. Many antibacterial products for cleaning and handwashing are sold today. Such products do not reduce the risk for symptoms of viral infectious diseases in otherwise healthy persons. This does not preclude the potential contribution of antibacterial products to reducing symptoms of bacterial diseases in the home.

Cat. No. Product Name Effect Purity Chemical Structure
  • HY-149271
    Anti-MRSA agent 7
    		Inhibitor
    Anti-MRSA agent 7 (Compound 12) is a potent antibacterial agent. Anti-MRSA agent 7 inhibits S. aureus DNA gyrase, E. coli DNA gyrase, S. aureus topo IV and E. coli topo IV with IC50s of 0.185, 0.365, 0.341 and 0.059 μM, respectively.
    Anti-MRSA agent 7
  • HY-N6725S
    Sterigmatocystine-13C18
    		Inhibitor
    Sterigmatocystine-13C18 is 13C labeled 2,6-Dimethoxyphenol (HY-W003972). 2,6-Dimethoxyphenol is a phenolic compound that is extensively used for the measurement of laccase activity.
    Sterigmatocystine-<sup>13</sup>C<sub>18</sub>
  • HY-W013780S
    Fmoc-Pro-OH-1-13C
    		Inhibitor
    Fmoc-Pro-OH-13C is a 13C-labeled Fmoc-Pro-OH (HY-W013780). Fmoc-Pro-OH is a proline derivative.
    Fmoc-Pro-OH-1-<sup>13</sup>C
  • HY-123022
    Tomopenem
    		Inhibitor
    Tomopenem (CS-023; RO4908463; R-115685) is a longer-half-life parenteral carbapenem. Tomopenem shows broad activity against 63 reference species. The activity of tomopenem against 293 clinical isolates is potent (MIC90, 0.06 to 4 μg/mL). Antianaerobic activity.
    Tomopenem
  • HY-127160R
    Benzoxonium chloride (Standard)
    		Inhibitor
    Benzoxonium (chloride) (Standard) is the analytical standard of Benzoxonium (chloride). This product is intended for research and analytical applications. Benzoxonium chloride is an anti-leishmanial agent. Benzoxonium chloride inhibits bacteria, certain protozoa, yeasts and non-spore forming organisms.
    Benzoxonium chloride (Standard)
  • HY-168853
    Antibacterial agent 261
    		Inhibitor
    Antibacterial agent 261 (compound 43) is a potent inhibitor of peptidomimetic peptide deformylase (PDF), with IC50 of 2.5 and 10.6 nM for S. aureus and E. coli, respectively.
    Antibacterial agent 261
  • HY-17395B
    Terbinafine lactate
    		Inhibitor
    Terbinafine lactate (TDT 067 lactate) is an orally active and potent antifungal agent. Terbinafine lactate is a potent non-competitive inhibitor of squalene epoxidase from Candida, with a Ki of 30 nM. Terbinafine lactate also shows antibacterial activity against certain Gram-positive and Gram-negative bacteria. Terbinafine (lactate) is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
    Terbinafine lactate
  • HY-151514
    Antituberculosis agent-5
    		Inhibitor 99.76%
    Antituberculosis agent-5 (compound 52) is a nitrofuranylamide derivative, inhibits M. tuberculosis UDP-Gal mutase. Antituberculosis agent-5 inhibits Glf activity with an IC50 value of 99 μM/mL and resists tuberculosis (TB) with a MIC value of 1.6 μg/mL.
    Antituberculosis agent-5
  • HY-W686760A
    Bromamphenicol
    		Inhibitor
    Bromamphenicol (Compound Ib) is a derivative of Chloramphenicol (HY-B0239), and exhibits antibacterial activity. Bromamphenicol binds to S50 ribosomal subunit, interfers with the activity of peptidyl transferase, and exhibits inhibitory activity against protein synthesis.
    Bromamphenicol
  • HY-P10907
    Zaloganan
    		Inhibitor
    Zaloganan exhibits board-spectrum antibacterial activity through disruption of bacterial membranes.
    Zaloganan
  • HY-B0455AR
    Lomefloxacin (Standard)
    		Inhibitor
    Lomefloxacin (Standard) is the analytical standard of Lomefloxacin. This product is intended for research and analytical applications. Lomefloxacin (SC47111A) is a broad-spectrum quinolone antibiotic, with antimicrobial activity. Lomefloxacin is used for the research of respiratory tract infections, genitourinary infections, gastrointestinal infections, ENT infections, etc..
    Lomefloxacin (Standard)
  • HY-P10158
    PMAP-36
    		Inhibitor
    PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance.
    PMAP-36
  • HY-40156A
    Mycobacterium Tuberculosis-IN-5
    		Inhibitor
    Mycobacterium Tuberculosis-IN-5 (Compound 11) is the HCl salt form of 5-Fluoroindole (HY-40156). Mycobacterium Tuberculosis-IN-5 is an antibacterial agent, that inhibits Mycobacterium tuberculosis with a MIC of 29.1 μM. Mycobacterium Tuberculosis-IN-5 exhibits metabolic stability in rat liver microsomes. Mycobacterium Tuberculosis-IN-5 exhibits anti-tuberculosis efficacy in mice.
    Mycobacterium Tuberculosis-IN-5
  • HY-125524
    Antibacterial agent 199
    		Inhibitor
    Antibacterial agent 199 (Compound 2) is an activator for caseinolytic protease (ClpP) with a Kd of 0.7 μM. Antibacterial agent 199 exhibits antibacterial efficacy against Gram-positive strains Staphylococcus aureus, Streptococcus pneumoniae and Gram-negative strain Neisseria meningitidis, with MICs of 16, 0.5 and 0.5 μg/mL, respectively.
    Antibacterial agent 199
  • HY-129751
    Nitrovin hydrochloride
    		Inhibitor
    Nitrovin hydrochloride is an antibacterial growth promoter. Nitrovin hydrochloride induces ROS-mediated non-apoptotic and apoptotic-like cell death by targeting TrxR1. Nitrovin hydrochloride has anticancer activity, with IC50 values of 1.31-6.60 μM for tumor and normal cells.
    Nitrovin hydrochloride
  • HY-B1828
    Spectinomycin
    		Inhibitor
    Spectinomycin is a broad-spectrum antibiotic and inhibits the growth of a variety of gram-positive and gram-negative organisms. Spectinomycin acts by selectively targeting to the bacterial ribosome and interrupting protein synthesis. Spectinomycin is also a noncompetitive inhibitor of td intron RNA.
    Spectinomycin
  • HY-161258
    Antibacterial agent 181
    		Inhibitor
    Antibacterial agent 181 (Compound 3f) is a potent ciprofloxacin cationic antibacterial agent with low cytotoxicity. The MIC values of Antibacterial agent 181 against Staphylococcus aureus and Escherichia coli are both 2 μg/mL.
    Antibacterial agent 181
  • HY-123515
    Clorobiocin
    		Inhibitor
    Clorobiocin is a MlaC protein inhibitor that could bind to the MlaC protein. Clorobiocin has antibacterial effects.
    Clorobiocin
  • HY-172606
    NagZ-IN-1
    		Inhibitor
    NagZ-IN-1 (Compound 11h) is an inhibitor of β-N-acetylglucosaminidase with a Ki of 3.3 μM. NagZ-IN-1 can be used in the field of antibacterial research, especially for studies related to Pseudomonas aeruginosa infections.
    NagZ-IN-1
  • HY-W026644
    Acridine-9-carboxaldehyde
    Acridine-9-carboxaldehyde (Acridine-9-carbaldehyde) is a bioactive compound with potential antibacterial and antitumor activities. Acridine-9-carboxaldehyde is widely used as a building block in compound development to synthesize various bioactive derivatives. Acridine-9-carboxaldehyde exhibits significant cytotoxicity against certain cancer cells, making it an important candidate in cancer inhibition research.
    Acridine-9-carboxaldehyde
Cat. No. Product Name / Synonyms Application Reactivity