2. Signaling Pathways
  3. Anti-infection
  4. Bacterial

Bacterial

Bacterial

Related Products

PDF 14.26 MB

Anything that destroys bacteria or suppresses their growth or their ability to reproduce. Heat, chemicals such as chlorine, and antibiotic drugs all have antibacterial properties. Many antibacterial products for cleaning and handwashing are sold today. Such products do not reduce the risk for symptoms of viral infectious diseases in otherwise healthy persons. This does not preclude the potential contribution of antibacterial products to reducing symptoms of bacterial diseases in the home.

Cat. No. Product Name Effect Purity Chemical Structure
  • HY-P10907
    Zaloganan
    		Inhibitor
    Zaloganan exhibits board-spectrum antibacterial activity through disruption of bacterial membranes.
    Zaloganan
  • HY-B0455AR
    Lomefloxacin (Standard)
    		Inhibitor
    Lomefloxacin (Standard) is the analytical standard of Lomefloxacin. This product is intended for research and analytical applications. Lomefloxacin (SC47111A) is a broad-spectrum quinolone antibiotic, with antimicrobial activity. Lomefloxacin is used for the research of respiratory tract infections, genitourinary infections, gastrointestinal infections, ENT infections, etc..
    Lomefloxacin (Standard)
  • HY-P10158
    PMAP-36
    		Inhibitor
    PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance.
    PMAP-36
  • HY-40156A
    Mycobacterium Tuberculosis-IN-5
    		Inhibitor
    Mycobacterium Tuberculosis-IN-5 (Compound 11) is the HCl salt form of 5-Fluoroindole (HY-40156). Mycobacterium Tuberculosis-IN-5 is an antibacterial agent, that inhibits Mycobacterium tuberculosis with a MIC of 29.1 μM. Mycobacterium Tuberculosis-IN-5 exhibits metabolic stability in rat liver microsomes. Mycobacterium Tuberculosis-IN-5 exhibits anti-tuberculosis efficacy in mice.
    Mycobacterium Tuberculosis-IN-5
  • HY-125524
    Antibacterial agent 199
    		Inhibitor
    Antibacterial agent 199 (Compound 2) is an activator for caseinolytic protease (ClpP) with a Kd of 0.7 μM. Antibacterial agent 199 exhibits antibacterial efficacy against Gram-positive strains Staphylococcus aureus, Streptococcus pneumoniae and Gram-negative strain Neisseria meningitidis, with MICs of 16, 0.5 and 0.5 μg/mL, respectively.
    Antibacterial agent 199
  • HY-129751
    Nitrovin hydrochloride
    		Inhibitor
    Nitrovin hydrochloride is an antibacterial growth promoter. Nitrovin hydrochloride induces ROS-mediated non-apoptotic and apoptotic-like cell death by targeting TrxR1. Nitrovin hydrochloride has anticancer activity, with IC50 values of 1.31-6.60 μM for tumor and normal cells.
    Nitrovin hydrochloride
  • HY-B1828
    Spectinomycin
    		Inhibitor
    Spectinomycin is a broad-spectrum antibiotic and inhibits the growth of a variety of gram-positive and gram-negative organisms. Spectinomycin acts by selectively targeting to the bacterial ribosome and interrupting protein synthesis. Spectinomycin is also a noncompetitive inhibitor of td intron RNA.
    Spectinomycin
  • HY-161258
    Antibacterial agent 181
    		Inhibitor
    Antibacterial agent 181 (Compound 3f) is a potent ciprofloxacin cationic antibacterial agent with low cytotoxicity. The MIC values of Antibacterial agent 181 against Staphylococcus aureus and Escherichia coli are both 2 μg/mL.
    Antibacterial agent 181
  • HY-123515
    Clorobiocin
    		Inhibitor
    Clorobiocin is a MlaC protein inhibitor that could bind to the MlaC protein. Clorobiocin has antibacterial effects.
    Clorobiocin
  • HY-172606
    NagZ-IN-1
    		Inhibitor
    NagZ-IN-1 (Compound 11h) is an inhibitor of β-N-acetylglucosaminidase with a Ki of 3.3 μM. NagZ-IN-1 can be used in the field of antibacterial research, especially for studies related to Pseudomonas aeruginosa infections.
    NagZ-IN-1
  • HY-W026644
    Acridine-9-carboxaldehyde
    Acridine-9-carboxaldehyde (Acridine-9-carbaldehyde) is a bioactive compound with potential antibacterial and antitumor activities. Acridine-9-carboxaldehyde is widely used as a building block in compound development to synthesize various bioactive derivatives. Acridine-9-carboxaldehyde exhibits significant cytotoxicity against certain cancer cells, making it an important candidate in cancer inhibition research.
    Acridine-9-carboxaldehyde
  • HY-139754
    Antibacterial agent 37
    		Inhibitor
    Antibacterial agent 37 is an antibacterial agent extracted from patent WO2015063714A1, compound B. Antibacterial agent 37 can be used for the research of bacterial infections.
    Antibacterial agent 37
  • HY-P2324A
    Gramicidin A TFA
    		Inhibitor
    Gramicidin A (TFA) is a peptide component of gramicidin, an antibiotic mixture originally isolated from B. brevis. Gramicidin A (TFA) is a highly hydrophobic channel-forming ionophore that forms channels in model membranes that are permeable to monovalent cations. Gramicidin A (TFA) induces degradation of hypoxia inducible factor 1 α (HIF-1α).
    Gramicidin A TFA
  • HY-N3342
    Macrocarpal E
    		Inhibitor
    Macrocarpal E is a potent antibacterial agent. Macrocarpal E is a phloroglucinol dialdehyde diterpene derivatives that can be found in the leaves of Eucalyptus macrocarpa.
    Macrocarpal E
  • HY-N15645
    α-Mycolic acid, keto cis
    		Inhibitor
    α-Mycolic acid, keto cis is a structural lipid component of mycobacterial cell wall. α-Mycolic acid, keto cis can be isolated from Mycobacterium tuberculosis Canetti. α-Mycolic acid, keto cis significantly modulates membrane permeability and stability, promising for mycobacterium tuberculosis infection research.
    α-Mycolic acid, keto cis
  • HY-123598
    Corynecin III
    		Inhibitor
    Corynecin III is a Chloramphenicol (HY-B0239)-like antibiotic, which is found in Corynebacterium. Corynecin III inhibits the growth of Gram-positive and Gram-negative bacteria with MIC values of 2.6-83 μg/mL.
    Corynecin III
  • HY-W008226R
    Phloracetophenone (Standard)
    		Inhibitor
    Oxprenolol (hydrochloride) (Standard) is the analytical standard of Oxprenolol (hydrochloride). This product is intended for research and analytical applications. Oxprenolol hydrochloride (Ba 39089) is an orally bioavailable β-adrenergic receptor (β-AR) antagonist with a Ki of 7.10 nM in a radioligand binding assay using rat heart muscle.
    Phloracetophenone (Standard)
  • HY-P10306
    Cys-LL37
    		Inhibitor
    Cys-LL37 is a biomaterial with antimicrobial properties developed by covalently fixing to the surface of titanium. Cys-LL37 uses a flexible hydrophilic polyethylene glycol spacer and selective n-terminal coupling LL37, a surface peptide layer that kills bacteria on contact is formed. Cys-LL37 can be used in research to develop new antimicrobial biomaterials.
    Cys-LL37
  • HY-109587A
    BM635 hydrochloride
    		Inhibitor
    BM635 hydrochloride is a MmpL3 inhibitor with outstanding anti-mycobacterial activity. BM635 hydrochloride has an MIC50 of 0.08 μM against M.tuberculosis H37Rv. BM635 hydrochloride doubles the in vivo exposure with respect to the free base BM635.
    BM635 hydrochloride
  • HY-121096
    Funalenone
    		Inhibitor
    Funalenone (BMS-304245) is a MraY + MurG inhibitor with an IC50 of 25.5 μM in a MraY + MurG membrane plate assay. Funalenone inhibits Staphylococcus aureus (A15090) with an MIC of 64 μg/mL. Funalenone also inhibits MMP-1 with an IC50 of 170 μM.
    Funalenone
Cat. No. Product Name / Synonyms Application Reactivity