Cecropin A TFA

Cat. No.: HY-P1539A: Data Sheet
SDS
Handling Instructions
FAQs
Technical Support

Cecropin A TFA is a linear 37-residue antimicrobial polypeptide isolated from Hyalaphora cecropia pupae. Cecropin A TFA exhibits anti-bacterial, anti-inflammatory and anti-cancer activity.

For research use only. We do not sell to patients.

Cecropin A TFA Chemical Structure

Size	Price	Stock
5 mg		Ask For Quote & Lead Time
10 mg		Ask For Quote & Lead Time

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of Cecropin A TFA:

Cecropin A

Other Forms of Cecropin A TFA:

Cecropin A In-stock

1 Publications Citing Use of MCE Cecropin A TFA

•Probiotics Antimicrob Proteins. 2024 Dec 21. [Abstract]

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All Antibiotic Isoform Specific Products:

View All Isoforms

Aminoglycoside Glycopeptide Lipopeptide Macrolide Oxazolidinone Quinolone Tetracycline β-lactam

Biological Activity
Purity & Documentation
References
Customer Review

Description

Cecropin A TFA is a linear 37-residue antimicrobial polypeptide isolated from Hyalaphora cecropia pupae. Cecropin A TFA exhibits anti-bacterial, anti-inflammatory^[1] and anti-cancer activity^[2].

In Vitro

Cecropin A (10, 20, 30, 40 and 50 μM) induces cytotoxicity on HL-60 cells in a dose-dependent manner. Cecropin A induces apoptosis independent of caspase activation^[1].
Cecropin A shows good antibacterial activity against both multidrug-resistant Gram-negative bacteria such as A. baumanii (MDRAB) and multidrug-resistant P. aeruginosa (MDRPA) with IC₅₀s of 0.5-1 μM.
Cecropin A (0.1, 0.25 μM) exhibits anti-inflammatory activities. Cecropin A (25 μM) effectively suppresses the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA and slightly inhibits the expression of mMIP-1 mRNA. Cecropin A also effectively inhibits LPS-induced phosphorylation of ERK, JNK, p38 MAPK, and reduced the expression of COX-2^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4003.78 (free base)

Formula

C₁₈₄H₃₁₃N₅₃O₄₆.xC₂HF₃O₂

Appearance

Solid

Color

White to off-white

Sequence

Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2

Sequence Shortening

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

Structure Classification

Initial Source

Microorganisms

Hyalaphora cecropia

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation

Data Sheet (283 KB) SDS (252 KB) Handling Instructions (2659 KB)

References

[1]. Cerón JM, et al. The antimicrobial peptide cecropin A induces caspase-independent cell death in human promyelocytic leukemia cells. Peptides. 2010 Aug;31(8):1494-503. [Content Brief]

[2]. Lee E, et al. Anti-inflammatory activities of cecropin A and its mechanism of action. Arch Insect Biochem Physiol. 2015 Jan;88(1):31-44. [Content Brief]

Cecropin A TFA Related Classifications

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Cecropin ABacterialAntibioticInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Requested Quantity *

Applicant Name *

Salutation

Email Address *

Phone Number *

Department

Organization Name *

City

State

Country or Region *

Remarks

Product Name

Lot #

Applicant Name *

Email Address *

Phone Number

Department *