1. Search Result
Search Result
Results for "

C-terminal peptide

" in MedChemExpress (MCE) Product Catalog:

50

Inhibitors & Agonists

55

Peptides

1

Inhibitory Antibodies

1

Natural
Products

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-P2746

    EC 3.4.2.2

    Endogenous Metabolite Metabolic Disease
    Carboxypeptidase B, Porcine pancreas (EC 3.4.2.2) is a peptide exonuclease that can specifically degrade peptide chains. Carboxypeptidase B is progressively degraded from the C-terminal to release free amino acids. Carboxypeptidase B hydrolyzes only peptide bonds with basic amino acids (such as arginine and lysine) as C-terminal residues .
    Carboxypeptidase B, Porcine pancreas
  • HY-E70201

    EC 3.4.2.2 (MS grade)

    Endogenous Metabolite Others
    Carboxypeptidase B (MS grade) is a peptide exonuclease that can specifically degrade peptide chains. Carboxypeptidase B (MS grade) is progressively degraded from the C-terminal to release free amino acids. Carboxypeptidase B (MS grade) hydrolyzes only peptide bonds with basic amino acids (such as arginine and lysine) as C-terminal residues .
    Carboxypeptidase B (MS grade)
  • HY-P3418

    CCR ERK Inflammation/Immunology
    CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research .
    CKLF1-C27
  • HY-P1465

    Human secretin

    Secretin Receptor Metabolic Disease Cancer
    Secretin (28-54), human is a 27-amino acid residue C-terminally amidated peptide, which acts on human secretin receptors .
    Secretin (28-54), human
  • HY-P0312
    c-Myc Peptide TFA
    1 Publications Verification

    c-Myc Cancer
    c-Myc Peptide (TFA) is a synthetic peptide corresponding to the C-terminal amino acids (410-419) of human c-myc protein, and participates in regulation of growth-related gene transcription.
    c-Myc Peptide TFA
  • HY-P1465A

    Human secretin TFA

    Secretin Receptor Metabolic Disease Cancer
    Secretin (28-54), human TFA is a 27-amino acid residue C-terminally amidated peptide, which acts on human secretin receptors .
    Secretin (28-54), human TFA
  • HY-P0199

    Human pancreatic polypeptide

    Neuropeptide Y Receptor Metabolic Disease Endocrinology
    Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.
    Pancreatic Polypeptide, human
  • HY-P10247

    Mitochondrial Metabolism Neurological Disease
    Amyloid precursor C-terminal peptide is cleaved from the C-terminus of Amyloid Precursor Protein (APP). Amyloid precursor C-terminal peptide accumulation causes mitochondrial morphology alteration and basal mitophagy failure, which indicates that amyloid precursor protein C-terminal peptide may correspond to an etiological trigger of Alzheimer’s disease (AD) pathology .
    Amyloid precursor C-terminal peptide
  • HY-P5923

    CXCR Inflammation/Immunology
    E70K is a CXCL8 C-terminal peptide with a substitution of glutamic acid (E) 70 with lysine (K). E70K can reduce neutrophil adhesion and migration during inflammation .
    E70K
  • HY-P3418A

    CCR ERK Inflammation/Immunology
    CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research .
    CKLF1-C27 TFA
  • HY-P10300

    IL-8 (54-72)

    CXCR Inflammation/Immunology
    CXCL8 (54-72) is a C-terminal peptide based on the chemokine CXCL8. CXCL8 (54-72) has an interaction between a long and highly positively charged C-terminal region and a negative charge on the GAG that binds to the GAG. CXCL8 (54-72) can inhibit the adhesion and migration of neutrophils and adhesion of endothelial cells. CXCL8 (54-72) can be used to study chemokines in inflammatory response .
    CXCL8 (54-72)
  • HY-P0144

    CD47 Apoptosis Inflammation/Immunology
    Thrombospondin-1 (1016-1023) (human, bovine, mouse), is the C-terminal end of the native sequence of Thrombospondin-1 (TSP-1), is a CD47 agonist peptide .
    Thrombospondin-1 (1016-1023) (human, bovine, mouse)
  • HY-P4058

    CGRP free acid

    CGRP Receptor Neurological Disease
    Calcitonin gene-related peptide (CGRP) free acid is the deamidated form of α-CGRP(human) (HY-P1071). Calcitonin gene-related peptide can be used to study the effect of C-terminal amidation on CGRP .
    Calcitonin gene-related peptide free acid
  • HY-P1841

    Endogenous Metabolite Apoptosis Metabolic Disease
    Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
    Glucagon-Like Peptide (GLP) II, human
  • HY-P5124

    KLVFF

    Amyloid-β Neurological Disease
    β-Amyloid peptide(16-20) is a amino acid sequences (KLVFF) of Amyloid-β (Abeta). β-Amyloid peptide(16-20) is an effective inhibitor of Abeta fibril formation, with RG-/-GR-NH2 residues added at N- and C-terminal ends to aid solubility) .
    β-Amyloid peptide(16-20)
  • HY-W015461

    DL-α-Aminocaprylic acid; DL-2-Aminocaprylic acid

    Bacterial Infection
    2-Aminooctanoic acid (DL-α-Aminocaprylic acid) is a fatty acid with an amino functional group that can be directly coupled at both the C-terminal and N-terminal with antimicrobial peptides (AMP) derived from lactoferrin B to enhance antibacterial activity .
    2-Aminooctanoic acid
  • HY-P11185

    HSP Cancer
    Hsp90β decapeptide is a C-terminal peptide of Hsp90β, which contains conserved TPR-domain MEEVD. Hsp90β decapeptide is able to bind tightly the Tah1 protein with a Kd of 1.0 μM .
    Hsp90β decapeptide
  • HY-P5391

    Bacterial Others
    LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)
    LL-37(17-32)
  • HY-P1191

    TI-JIP; JIP-1 peptide; JIPtide

    JNK Others
    JIP-1(153-163) (TI-JIP) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
    JIP-1(153-163)
  • HY-P3901

    Somatostatin Receptor Neurological Disease
    [Leu8,D-Trp22,Tyr25] Somatostatin-28 is the analog of Somatostatin-28. Somatostatin-28 is a intestinal peptide containing somatostatin in its C-terminal portion .
    [Leu8,D-Trp22,Tyr25] Somatostatin-28
  • HY-P1191A

    TI-JIP TFA; JIP-1 peptide TFA; JIPtide TFA

    JNK Others
    JIP-1(153-163) TFA (TI-JIP TFA) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
    JIP-1(153-163) TFA
  • HY-E70574

    Biochemical Assay Reagents Others
    Trypsin/Lys-C complex protease (MS grade) combines Trypsin and Lys-C, two recombinant proteases, to achieve efficient peptide bond hydrolysis. Trypsin specifically cleaves the C-terminal peptide bonds of arginine (R) and lysine (K), while Lys-C specifically cleaves the C-terminal peptide bonds of lysine (K). This combination overcomes issues such as the slower digestion rate of lysine and arginine by rTrypsin, PTM changes on lysine, or hydrophobic C-termini (such as proline) that can lead to missed cleavage. Trypsin/Lys-C complex protease (MS grade) can be used to process complex protein samples that are difficult to enzymatically digest. Trypsin/Lys-C complex protease (MS grade) can be used for protein characterization, single-cell proteomics and large cohort proteomics studies.
    Trypsin/Lys-C complex protease (MS grade)
  • HY-P5497

    HIV Others
    C34 peptide is a biological active peptide. (This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.)
    C34 peptide
  • HY-P2980

    EC 3.4.2.1

    Endogenous Metabolite Others
    Carboxypeptidase A, Bovine pancreas (EC 3.4.2.1) is a zinc-containing metalloprotease, is often used in biochemical studies. Carboxypeptidase A catalyzes the hydrolysis of the peptide bonds that are adjacent to the C-terminal end of a polypeptide chain. Carboxypeptidase A is a prototypical enzyme for metalloproteases that plays important roles in biological systems .
    Carboxypeptidase A, Bovine pancreas
  • HY-P5370

    Amyloid-β Others
    Scrambled β-amyloid (1-40) is a biological active peptide. (Aβ (1-40) together with Aβ (1-42) are two major C-terminal variants of the Aβ protein constituting the majority of Aβs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40 HY-P0265)
    Scrambled β-amyloid (1-40)
  • HY-P1257

    Insulin Receptor Neurotensin Receptor Metabolic Disease
    Xenin-8, a C-terminal octapeptide, is a biologically active fragment of Xenin. Xenin is a 25-amino acid peptide of the neurotensin/xenopsin family. Xenin-8 stimulates basal insulin secretion and potentiates the insulin response to glucose in a dose-dependent manner (EC50=0.16 nM) .
    Xenin-8
  • HY-P5351A

    Transmembrane Glycoprotein Inflammation/Immunology Cancer
    Hyaluronan-binding peptide, biotin labeled TFA is a biological active peptide. (This peptide is a hyaluronan-binding peptide biotinylated through a C-terminal GGGSK linker. Hyaluronan (HA) is a nonsulfated glycosaminoglycan expressed in the extracellular matrix and on cell surfaces. HA plays a role in fertilization, embryonic development, wound healing, angiogenesis, leukocyte trafficking to inflamed tissues, and cancer metastasis. This peptide has been shown to block HA binding to CD44 receptors and inhibit T cell proliferation.) .
    Hyaluronan-binding peptide, biotin labeled TFA
  • HY-P5182

    Potassium Channel Inflammation/Immunology
    HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
    HsTX1
  • HY-P1257A

    Neurotensin Receptor Metabolic Disease
    Xenin-8 TFA, a C-terminal octapeptide, is a biologically active fragment of Xenin. Xenin is a 25-amino acid peptide of the neurotensin/xenopsin family. Xenin-8 TFA stimulates basal insulin secretion and potentiates the insulin response to glucose in a dose-dependent manner (EC50=0.16 nM) .
    Xenin-8 TFA
  • HY-107024

    OGP(10-14); Historphin

    Src Others
    Osteogenic Growth Peptide (10-14) (OGP(10-14)), the C-terminal truncated pentapeptide of osteogenic growth peptide (OGP), retains the full OGP-like activity. Osteogenic Growth Peptide (10-14) is responsible for the binding to the OGP receptor and activates an intracellular Gi-protein-MAP kinase signaling pathway. Osteogenic Growth Peptide (10-14) is a potent mitogen and stimulator of osteogenesis and hematopoiesis. Osteogenic Growth Peptide (10-14) acts as a Src inhibitor .
    Osteogenic Growth Peptide (10-14)
  • HY-P5182A

    Potassium Channel Inflammation/Immunology
    HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
    HsTX1 TFA
  • HY-162832

    Amyloid-β Neurological Disease
    Amyloid-β-IN-1 (compound 13) is a synthetic peptide containing the hydrophobic C-terminal region "VVIA-NH2" and its reverse sequence "AIVV-NH2" of 42, which is an inhibitor. Amyloid-β-IN-1 can inhibit Aβ aggregation and has neuroprotective effects .
    Amyloid-β-IN-1
  • HY-P5461

    Bacterial Others
    CHRG01 is a biological active peptide. (CHRG01 is derived from human b-defensin 3 (hBD3) C-terminal amino acids 54 to 67, with all Cys residues substituted with Ser. This substitution removes all disulfide bond linkages within the sequence. CHRG01, like hBD3, displays electrostatic-dependent antimicrobial properties.)
    CHRG01
  • HY-P5771

    Sodium Channel Neurological Disease
    Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .
    Jingzhaotoxin-IX
  • HY-P3431

    iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-P1769

    Angiotensin Receptor Metabolic Disease Endocrinology
    Angiotensin II (5-8), human is an endogenous C-terminal fragment of the peptide vasoconstrictor angiotensin II . Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca 2+ levels. Angiotensin II also acts at the Na +/H + exchanger in the proximal tubules of the kidney .
    Angiotensin II (5-8), human
  • HY-P10251

    HIV Infection
    HIV gp120 (318-327) is a short sequence of the HIV-1 strain IIIB envelope peptide (rgpgrafvti) that corresponds to the conserved C-terminal region of the glycoprotein. HIV gp120 (318-327) is part of the HIV vaccine V3 peptide epitope, also known as the I10 peptide. However, HIV gp120 (318-327) lacks the A2 anchor residues recognized by epitope-specific CTLs but has structural features that confer promiscuous A2 binding .
    HIV gp120 (318-327)
  • HY-P3431A

    iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
  • HY-P991534

    Amyloid-β Neurological Disease
    PF-04382923 is a humanized IgG2Δa monoclonal antibody. PF-04382923 binds with high affinity to the free C-terminal regions of the amyloid-β peptides Aβ1-40 and Aβ1-42. PF-04382923 is indicated for the study of geographic atrophy (GA) associated with dry age-related macular degeneration (ARMD) .
    PF-04382923
  • HY-P5693

    Bacterial CMV HSV Infection
    HBA(111-142), an antimicrobial peptide, is a C-terminal 32-mer fragment of alpha-hemoglobin. HBA(111-142) has antibacterial activity against the ESKAPE panel of pathogens. HBA(111-142) forms amyloid fibrils, and has antiviral activities. HBA(111-142) inhibits measles and herpes viruses (HSV-1, HSV-2, HCMV) .
    HBA(111–142)
  • HY-P3982

    CCR Inflammation/Immunology
    CKLF1-C19 is the C-terminal peptide of human chemokine-like factor 1 (CKLF1). CKLF1-C19 interacts with CCR4, and inhibits chemotaxis induced by both CKLF1 and CCL17. CKLF1-C19 can suppress allergic lung inflammation via inhibiting chemotaxis mediated by CCR3 and CCR4 .
    CKLF1-C19
  • HY-P5506

    Complement System Others
    C5a Receptor agonist, W5Cha (Peptide 1) is a selective complement C5a receptor (C5aR) agonist (EC50=0.2 μM), a hexapeptide derived from the C-terminus of C5a with specific amino acid modifications. C5a Receptor agonist, W5Cha is able to interact with the Arg-206 site of the C5a receptor through its C-terminal arginine, thereby activating the receptor .
    C5a Receptor agonist, W5Cha
  • HY-118161

    beta-1-Adamantylaspartic acid

    Biochemical Assay Reagents Others
    1-Adamantylaspartate is a newly developed β-β-1-imidopropionic acid used to synthesize the C-terminal octapeptide of the β subunit of human chorionic gonadotropin (hCG) and the hexadecapeptide of the α subunit of the insulin receptor (30-55) by conventional solution methods and solid phase methods, aiming to inhibit the formation of asparagine during the synthesis of asparagyl peptides. Studies have shown that β-β-1-imidopropionic acid is an effective protector of the β-carboxyl function of aspartic acid residues.
    1-Adamantylaspartate
  • HY-P1059

    iGluR Neurological Disease
    Pep2-AVKI is a selective peptide inhibitor of the binding of the AMPA receptor subunit (GluR2) at the C-terminal PDZ site to C-kinase (PICK1). Pep2-AVKI does not affect the binding of (AMPA-type glutamate receptor) GluA2 to GRIP or ABP. Pep2-AVKI does not increase the amplitude of AMPA currents. pep2-AVKI can be used to study neurological diseases .
    Pep2-AVKI
  • HY-P1210

    Melanocortin Receptor Endocrinology
    Lys-γ3-MSH(human) is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
    Lys-γ3-MSH(human)
  • HY-P1210A

    Melanocortin Receptor Endocrinology
    Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) TFA is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) TFA can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
    Lys-γ3-MSH(human) TFA
  • HY-P1056

    iGluR Neurological Disease
    pep2-SVKI is a selective peptide inhibitor. pep2-SVKI inhibits the binding of AMPA-type glutamate receptor (GluA2) (C-terminal PDZ site) to glutamate receptor interacting protein (GRIP), AMPA receptor binding protein (ABP), and C-kinase interacting protein (PICK1). pep2-SVKI increases the amplitude of AMPA receptor-mediated currents and blocks long-term depression (LTD). pep2-SVKI can be used to study neurological diseases .
    pep2-SVKI
  • HY-P11092

    Endogenous Metabolite Neurological Disease
    TLQP-62 (mouse,rat) is a secreted C-terminal peptide that can be derived from protein VGF. TLQP-62 activates the BDNF-TrkB signaling pathway, inducing acute, transient phosphorylation of TrkB receptor and downstream CREB (Ser133) phosphorylation. TLQP-62 demonstrates excellent efficacy in promoting long-term fear memory formationin wild-type mice and reversing memory impairment in VGF heterozygous knock-out mice. TLQP-62 can be used for the study of memory-related neurological disorders (e.g., Alzheimer’s disease, frontotemporal dementia) .
    TLQP-62 (mouse,rat)
  • HY-P2535

    GLP Receptor Metabolic Disease
    Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human is an C-terminal-labelled biotinylated GLP-1 (7-36) amide.
    Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human
  • HY-P10405

    Dopamine Receptor Neurological Disease
    TAT-D1 peptide is a selective D1-D2 heterogeneous antagonist. TAT-D1 peptide destroys the heterodimer of the D1-D2 receptor by interacting with the specific domain of the D2 receptor through its unique amino acid sequence, in particular the two glutamate residues at the C terminal of the D1 receptor. TAT-D1 peptide can be used to study the role of D1-D2 receptor heterodimers in the regulation of depressive and anxiety-like behaviors .
    TAT-D1 peptide

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: