2. Metabolic Enzyme/Protease
  3. Endogenous Metabolite
  4. TLQP-62 (mouse,rat)

TLQP-62 (mouse,rat) is a secreted C-terminal peptide that can be derived from protein VGF. TLQP-62 activates the BDNF-TrkB signaling pathway, inducing acute, transient phosphorylation of TrkB receptor and downstream CREB (Ser133) phosphorylation. TLQP-62 demonstrates excellent efficacy in promoting long-term fear memory formationin wild-type mice and reversing memory impairment in VGF heterozygous knock-out mice. TLQP-62 can be used for the study of memory-related neurological disorders (e.g., Alzheimer’s disease, frontotemporal dementia).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

TLQP-62 (mouse,rat)

TLQP-62 (mouse,rat) Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

TLQP-62 (mouse,rat) Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

TLQP-62 (mouse,rat) is a secreted C-terminal peptide that can be derived from protein VGF. TLQP-62 activates the BDNF-TrkB signaling pathway, inducing acute, transient phosphorylation of TrkB receptor and downstream CREB (Ser133) phosphorylation. TLQP-62 demonstrates excellent efficacy in promoting long-term fear memory formationin wild-type mice and reversing memory impairment in VGF heterozygous knock-out mice. TLQP-62 can be used for the study of memory-related neurological disorders (e.g., Alzheimer’s disease, frontotemporal dementia)[1].

In Vitro

TLQP-62 (10 μM, 10 min) acutely and transiently activates TrkB receptor phosphorylation[1].
TLQP-62 (10 μM, 30 min) induces CREB phosphorylation (Ser133) and promotes cofilin phosphorylation in mouse hippocampal slices[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

TLQP-62 (mouse,rat) Related Antibodies
In Vivo

TLQP-62 (0.3 μg/side, bilateral hippocampal injection, once immediately after training) enhances long-term fear memory formation in mice[1].
TLQP-62 (5 mg/kg, i.p., once immediately after CFC training) reverses memory impairment in male N2F1 VGF heterozygous knock-out mice[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male C57BL/6J mice (2-3 months old)[1]
Dosage: 0.3 μg/side
Administration: Bilateral hippocampal injection once immediately after training
Result: Achieved enhanced long-term fear memory formation.
Showed significant induction of CREB phosphorylation (Ser133) in the dorsal hippocampus, with a magnitude and kinetics similar to recombinant BDNF-induced CREB phosphorylation.
Appeared no significant effects on short-term memory or locomotor activity.
Animal Model: VGF germline heterozygous knock-out mouse[1]
Dosage: 5 mg/kg
Administration: i.p. once immediately after CFC training
Result: Achieved reversed memory impairment in VGF heterozygous knock-out mice.
Restored Rac1 mRNA induction in the dorsal hippocampus.
Showed no enhancement of memory performance.
Molecular Weight

7401.04

Formula

C318H499N109O97
Sequence

Thr-Leu-Gln-Pro-Pro-Ala-Ser-Ser-Arg-Arg-Arg-His-Phe-His-His-Ala-Leu-Pro-Pro-Ala-Arg-His-His-Pro-Asp-Leu-Glu-Ala-Gln-Ala-Arg-Arg-Ala-Gln-Glu-Glu-Ala-Asp-Ala-Glu-Glu-Arg-Arg-Leu-Gln-Glu-Gln-Glu-Glu-Leu-Glu-Asn-Tyr-Ile-Glu-His-Val-Leu-Leu-His-Arg-Pro
Sequence Shortening

TLQPPASSRRRHFHHALPPARHHPDLEAQARRAQEEADAEERRLQEQEELENYIEHVLLHRP
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

TLQP-62 (mouse,rat) Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

TLQP-62 (mouse,rat)Endogenous MetaboliteBDNFmemoryRac1TLQP-62TrkBVGFInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TLQP-62 (mouse,rat)
Cat. No.:
HY-P11092
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.