1. Search Result
Search Result
Results for "

α2δ

" in MedChemExpress (MCE) Product Catalog:

35

Inhibitors & Agonists

2

Peptides

2

Natural
Products

1

Recombinant Proteins

16

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-108006
    Mirogabalin besylate
    5 Publications Verification

    DS 5565 besylate

    Calcium Channel Neurological Disease
    Mirogabalin besylate is a selective and orally available ligand for the α2δ subunit of voltage-gated calcium channels, with Kds of 13.5 nM, 22.7 nM, 27 nM, and 47.6 nM for human α2δ-1, human α2δ-2, rat α2δ-1, and rat α2δ-2, respectively.
    Mirogabalin besylate
  • HY-12650
    Mirogabalin
    5 Publications Verification

    DS5565

    Calcium Channel Neurological Disease
    Mirogabalin (DS-5565) is a novel, preferentially selective α2δ-1 ligand characterized by high potency and selectivity to the α2δ-1 subunit of voltage-sensitive calcium channel complexes in the CNS.
    Mirogabalin
  • HY-U00388

    Calcium Channel Neurological Disease
    α2δ ligand 1 is a ligand to the α2δ-1 subunit of voltage-sensitive calcium channel, extracted from patent US20040186177.
    α2δ ligand 1
  • HY-148866

    Calcium Channel Neurological Disease Endocrinology
    Cavα2δ1&NET-IN-3 (example 216) is an inhibitor of the subunit α2δ of voltage-gated calcium channels (VGCC) and noradrenaline transporter (NET). Cavα2δ1&NET-IN-3 has Kis of 100-500 nM for human α2δ-1 subunit of Cav2.2 calcium channel and NET, respectively .
    Cavα2δ1&NET-IN-3
  • HY-132932

    Calcium Channel Others
    Cavα2δ-IN-1 shows high selectivity for voltage-gated calcium channels Cavα2δ-1 (Ki 6 nM) versus Cavα2δ-2 (Ki > 10000 nM).
    Cavα2δ-IN-1
  • HY-P3431

    iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-P3431A

    iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA
  • HY-12650R

    DS5565 (Standard)

    Reference Standards Calcium Channel Neurological Disease
    Mirogabalin (Standard) is the analytical standard of Mirogabalin. This product is intended for research and analytical applications. Mirogabalin (DS-5565) is a novel, preferentially selective α2δ-1 ligand characterized by high potency and selectivity to the α2δ-1 subunit of voltage-sensitive calcium channel complexes in the CNS.
    Mirogabalin (Standard)
  • HY-148863

    Calcium Channel Monoamine Transporter Inflammation/Immunology
    Cavα2δ1&NET-IN-2 (Compound 45CS) is a dual inhibitor of the α2δ‑1 subunit of voltage-gated calcium channels (Cavα2δ-1) and the norepinephrine transporter (NET). Cavα2δ1&NET-IN-2 inhibits Cavα2δ-1 with a Ki of 454 nM. Cavα2δ1&NET-IN-2 inhibits NET with a Ki of 59 nM and IC50 of 7 nM. Cavα2δ1&NET-IN-2 can be used for research of pain .
    Cavα2δ1&NET-IN-2
  • HY-148862

    Calcium Channel Monoamine Transporter Inflammation/Immunology
    Cavα2δ1&NET-IN-1 (Compound 59S) is a dual inhibitor of the α2δ‑1 subunit of voltage-gated calcium channels (Cavα2δ-1) and the norepinephrine transporter (NET). Cavα2δ1&NET-IN-1 inhibits Cavα2δ-1 with a Ki of 112 nM. Cavα2δ1&NET-IN-1 inhibits NET with a Ki of 383 nM and IC50 of 67 nM. Cavα2δ1&NET-IN-1 can be used for research of pain .
    Cavα2δ1&NET-IN-1
  • HY-12650S

    DS5565-13C2,d1 (Mixture of Diastereomers)

    Isotope-Labeled Compounds Others
    Mirogabalin-13C2,d1 (Mixture of Diastereomers) is a C13 and deuterium labeled Mirogabalin. Mirogabalin (DS-5565) is a novel, preferentially selective α2δ-1 ligand characterized by high potency and selectivity to the α2δ-1 subunit of voltage-sensitive calcium channel complexes in the CNS .
    Mirogabalin-13C2,d1 (Mixture of Diastereomers)
  • HY-12650A

    (rel)-DS5565

    Calcium Channel Neurological Disease
    (rel)-Mirogabalin ((rel)-DS5565) is a voltage-dependent calcium channel inhibitor that acts on the α2δ-1 subunit .
    (rel)-Mirogabalin
  • HY-U00250

    PD-0332334

    Calcium Channel Neurological Disease
    β-Amino Acid Imagabalin Hydrochloride (PD-0332334) is a ligand for the α2δ subunit of the voltage-dependent calcium channel.
    β-Amino Acid Imagabalin Hydrochloride
  • HY-136644A

    Calcium Channel Others
    PD-217014 is an α2δ ligand with visceral analgesic activity and can inhibit visceral hypersensitivity reactions. Its anti-allodynic effect is dose-dependent.
    PD-217014
  • HY-12650S1

    DS5565-d4

    Isotope-Labeled Compounds Calcium Channel Neurological Disease
    Mirogabalin-d4 (DS5565-d4) is a deuterated compound of Mirogabalin (HY-12650), a ligand that selectively targets the voltage-sensitive calcium channel complex α2δ-1 [2].
    Mirogabalin-d4
  • HY-169115

    Calcium Channel Inflammation/Immunology
    PD-0299685 is a potent Ca 2+ channel α2δ ligand. PD-0299685 is promising for research of refractory genito-urinary pain and interstitial cystitis/bladder pain syndrome [2].
    PD-0299685
  • HY-N0215
    L-Phenylalanine
    Maximum Cited Publications
    7 Publications Verification

    Phenylalanine

    Calcium Channel iGluR Endogenous Metabolite Metabolic Disease Cancer
    L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca + channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine
  • HY-N0215R

    Phenylalanine (Standard)

    Reference Standards Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine (Standard) is the analytical standard of L-Phenylalanine. This product is intended for research and analytical applications. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine (Standard)
  • HY-14856

    PD 0200390

    GABA Receptor Neurological Disease
    Atagabalin (PD 0200390) is a selective GABA (gamma-aminobutyric acid) receptor agonist with antianxiety and sedative effects. Atagabalin enhances the activity of the GABA receptor by binding to the α2δ subunit of the GABA receptor, thereby increasing the GABA mediated inhibition. This enhancement results in reduced excitability of neurons, helping to reduce anxiety and improve sleep. Atagabalin can be used to study neuropsychiatric disorders, anxiety or sleep disorders .
    Atagabalin
  • HY-169115A

    Calcium Channel Inflammation/Immunology
    (Rac)-PD0299685 is a Ca(2+) channel α2δ ligand that was investigated for relieving interstitial cystitis pain in a randomized, double-blind, placebo-controlled phase IIa study. (Rac)-PD0299685 demonstrated a clinically significant reduction in daily worst pain severity scores at the 60 mg dose compared to placebo. (Rac)-PD0299685 is also a potent voltage-dependent calcium channel inhibitor for the study of retina-related diseases.
    (Rac)-PD0299685
  • HY-N0215S6

    2-Amino-3-phenylpropionic acid-d5 hydrochloride

    Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    DL-Phenylalanine-d5 (hydrochloride) is the deuterium labeled DL-Phenylalanine hydrochloride. L-Phenylalanine hydrochloride is an essential amino acid isolated from Escherichia coli. L-Phenylalanine hydrochloride is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine hydrochloride is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine hydrochloride is widely used in the production of food flavors and pharmaceuticals [2] .
    DL-Phenylalanine-d5 hydrochloride
  • HY-N0215S13

    (S)-2-Amino-3-phenylpropionic acid-d1

    Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine-d is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-d1
  • HY-N0215S3

    (S)-2-Amino-3-phenylpropionic acid-d2

    Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine-d2 is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-d2
  • HY-N0215S

    (S)-2-Amino-3-phenylpropionic acid-d7

    Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine-d7 is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-d7
  • HY-N0215S1
    L-Phenylalanine-d8
    1 Publications Verification

    (S)-2-Amino-3-phenylpropionic acid-d8

    Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine-d8 is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-d8
  • HY-N0215S12
    L-Phenylalanine-d5
    1 Publications Verification

    Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine-d5 is the deuterium labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-d5
  • HY-N0215S7
    L-Phenylalanine-3-13C
    1 Publications Verification

    (S)-2-Amino-3-phenylpropionic acid-3-13C

    Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine-3- 13C is the 13C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-3-13C
  • HY-N0215S2
    L-Phenylalanine-13C
    1 Publications Verification

    (S)-2-Amino-3-phenylpropionic acid-13C

    Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine- 13C is the 13C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-13C
  • HY-N0215S5

    (S)-2-Amino-3-phenylpropionic acid-15N

    Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine- 15N is the 15N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-15N
  • HY-N0215S8
    L-Phenylalanine-13C6
    1 Publications Verification

    (S)-2-Amino-3-phenylpropionic acid-13C6

    Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine- 13C6 is the 13C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-13C6
  • HY-N0215S10

    (S)-2-Amino-3-phenylpropionic acid-13C9

    Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine- 13C9 is the 13C-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-13C9
  • HY-N0215S11

    (S)-2-Amino-3-phenylpropionic acid-13C9,15N

    Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine- 13C9, 15N is the 13C- and 15N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-13C9,15N
  • HY-N0215S14

    (S)-2-Amino-3-phenylpropionic acid-15N,d8

    Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine- 15N,d8 is the deuterium and 15N-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca2+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-15N,d8
  • HY-N0215S9

    (S)-2-Amino-3-phenylpropionic acid-13C9,15N,d8

    Isotope-Labeled Compounds Calcium Channel iGluR Endogenous Metabolite Metabolic Disease
    L-Phenylalanine- 13C9, 15N,d8 is the deuterium, 13C-, and 15-labeled L-Phenylalanine. L-Phenylalanine ((S)-2-Amino-3-phenylpropionic acid) is an essential amino acid isolated from Escherichia coli. L-Phenylalanine is a α2δ subunit of voltage-dependent Ca+ channels antagonist with a Ki of 980 nM. L-phenylalanine is a competitive antagonist for the glycine- and glutamate-binding sites of N-methyl-D-aspartate receptors (NMDARs) (KB of 573 μM ) and non-NMDARs, respectively. L-Phenylalanine is widely used in the production of food flavors and pharmaceuticals [2] .
    L-Phenylalanine-13C9,15N,d8
  • HY-142240

    HSK16149

    Calcium Channel Neurological Disease
    Crisugabalin (HSK16149) is a novel ligand of voltage-gated calcium channel (VGCC) α 2 δ subunit.
    Crisugabalin

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: