2. Recombinant Proteins
  3. Others
  4. CACNA2D1 Protein, Human (His-SUMO)

The CACNA2D1 protein, particularly its α-2/δ subunit, plays a key role in regulating calcium current density and activation/deactivation kinetics of voltage-dependent calcium channels. It contributes to excitation-contraction coupling, coordinating cellular processes. CACNA2D1 Protein, Human (His-SUMO) is the recombinant human-derived CACNA2D1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CACNA2D1 protein, particularly its α-2/δ subunit, plays a key role in regulating calcium current density and activation/deactivation kinetics of voltage-dependent calcium channels. It contributes to excitation-contraction coupling, coordinating cellular processes. CACNA2D1 Protein, Human (His-SUMO) is the recombinant human-derived CACNA2D1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background

The CACNA2D1 protein, specifically its alpha-2/delta subunit, assumes a pivotal role in the regulation of calcium current density and the activation/inactivation kinetics of voltage-dependent calcium channels. It plays a crucial part in excitation-contraction coupling, contributing to the coordination of cellular processes. The alpha-2/delta subunit forms a dimer with alpha-2-1 and delta-1 chains through disulfide linkage, constituting an essential structural component of voltage-dependent calcium channels. These channels are intricate multisubunit complexes, composed of alpha-1 (CACNA1), alpha-2 (CACNA2D), beta (CACNB), and delta (CACNA2D) subunits in a 1:1:1:1 ratio. The functional and structural involvement of CACNA2D1 underscores its significance in the precise modulation of calcium signaling and cellular responses.
Species

Human
Source

E. coli
Tag

N-6*His;N-SUMO
Accession

P54289 (Q528-N668)
Gene ID

781  [NCBI]
Molecular Construction
N-term
6*His-SUMO
CACNA2D1 (Q528-N668)
Accession # P54289
C-term
Synonyms
CA2D1_HUMAN; CACN A2; CACNA2; Cacna2d1; CACNL2A; Calcium channel L type alpha 2 polypeptide; Calcium channel voltage dependent alpha 2/delta subunit 1; CCHL2A; Dihydropyridine receptor alpha 2 subunit; Dihydropyridine sensitive L type calcium channel alpha 2/delta subunit; Dihydropyridine sensitive L type calcium channel subunits alpha 2/delta; L type calcium channel subunit alpha 2; MHS 3; MHS3; Voltage dependent calcium channel subunit alpha 2/delta 1; Voltage gated calcium channel subunit alpha 2/delta 1; Voltage-dependent calcium channel subunit delta-1; Voltage-gated calcium channel subunit alpha-2/delta-1
AA Sequence

QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN

Molecular Weight

Approximately 32.3 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

CACNA2D1 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CACNA2D1 Protein, Human (His-SUMO)
Cat. No.:
HY-P72109
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (0 KB) Français - FR (0 KB) Deutsch - DE (0 KB) Norwegian - NO (0 KB) Español - ES (0 KB) Swedish - SV (0 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.