2. Anti-infection
  3. Bacterial Antibiotic
  4. RL-37

RL-37 is an alpha-helical antimicrobial peptide. RL-37 can be isolated for rhesus monkey bone marrow. RL-37 rapidly permeabilizes the membranes of Escherichia coli ML-35p and lysed liposomes. RL-37 has effective antibacterial activity against staphylococci, such as wild-type and Methicillin (HY-121544)-resistant S. aureus strains and S. epidermidis ATCC 49741. RL-37 can be used for human skin infections research.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

RL-37

RL-37 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

RL-37 Related Antibodies

Top Publications Citing Use of Products

View All Antibiotic Isoform Specific Products:

View All Isoforms
Aminoglycoside Glycopeptide Lipopeptide Macrolide Oxazolidinone Quinolone Tetracycline β-lactam

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

RL-37 is an alpha-helical antimicrobial peptide. RL-37 can be isolated for rhesus monkey bone marrow. RL-37 rapidly permeabilizes the membranes of Escherichia coli ML-35p and lysed liposomes. RL-37 has effective antibacterial activity against staphylococci, such as wild-type and Methicillin (HY-121544)-resistant S. aureus strains and S. epidermidis ATCC 49741. RL-37 can be used for human skin infections research[1].

Molecular Weight

4100.86

Formula

C187H316N56O47
Sequence

Arg-Leu-Gly-Asn-Phe-Phe-Arg-Lys-Val-Lys-Glu-Lys-Ile-Gly-Gly-Gly-Leu-Lys-Lys-Val-Gly-Gln-Lys-Ile-Lys-Asp-Phe-Leu-Gly-Asn-Leu-Val-Pro-Arg-Thr-Ala-Ser
Sequence Shortening

RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

RL-37 Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

RL-37RL37RL 37BacterialAntibioticAlpha-helicalAntimicrobial peptideRhesus monkeyEscherichia coliS. aureusS. epidermidis ATCC 49741Human skin infectionsInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RL-37
Cat. No.:
HY-P11109
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.