1. Recombinant Proteins
  2. Others
  3. ZMYND19 Protein, Human (His)

ZMYND19 Protein, implicated in GPR24/MCH-R1 signaling, suggests a role in modulating the associated pathways. Its interaction with GPR24/MCH-R1 indicates regulatory involvement. Mechanisms and downstream effects of ZMYND19 in GPR24/MCH-R1 signaling require further elucidation. Exploring ZMYND19's functions may provide insights into its role in cellular responses, offering potential interventions in G protein-coupled receptor pathways. ZMYND19 Protein, Human (His) is the recombinant human-derived ZMYND19 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ZMYND19 Protein, implicated in GPR24/MCH-R1 signaling, suggests a role in modulating the associated pathways. Its interaction with GPR24/MCH-R1 indicates regulatory involvement. Mechanisms and downstream effects of ZMYND19 in GPR24/MCH-R1 signaling require further elucidation. Exploring ZMYND19's functions may provide insights into its role in cellular responses, offering potential interventions in G protein-coupled receptor pathways. ZMYND19 Protein, Human (His) is the recombinant human-derived ZMYND19 protein, expressed by E. coli , with N-6*His labeled tag.

Background

ZMYND19 Protein emerges as a potential regulatory molecule in GPR24/MCH-R1 signaling, implying a role in modulating the intricate pathways associated with GPR24/MCH-R1 activation. Its interaction with GPR24/MCH-R1 further supports its involvement in the regulatory processes of this signaling cascade. The specific mechanisms through which ZMYND19 influences GPR24/MCH-R1 signaling and the downstream effects of this interaction remain to be elucidated. Further exploration of ZMYND19's functions and its role in modulating GPR24/MCH-R1 signaling may provide valuable insights into its contributions to cellular responses and potentially offer avenues for targeted interventions in signaling pathways involving G protein-coupled receptors.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q96E35 (M1-R227)

Gene ID

116225  [NCBI]

Molecular Construction
N-term
6*His
ZMYND19 (M1-R227)
Accession # Q96E35
C-term
Protein Length

Full Length

Synonyms
Zinc Finger MYND Domain-Containing Protein 19; Melanin-Concentrating Hormone Receptor 1-Interacting Zinc Finger Protein; MCH-R1-Interacting Zinc Finger Protein; ZMYND19; MIZIP
AA Sequence

MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER

Predicted Molecular Mass
28.6 kDa
Molecular Weight

Approximately 32 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ZMYND19 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ZMYND19 Protein, Human (His)
Cat. No.:
HY-P71439
Quantity:
MCE Japan Authorized Agent: