1. Recombinant Proteins
  2. Others
  3. ZBP1 Protein, Human (His)

ZBP1 is an important innate sensor that defends against viruses by recognizing Z-RNA structures and inducing PANoptosis. It binds Z-RNA through TNF-α family members and stimulates RIPK3 and MLKL to activate necroptosis. ZBP1 Protein, Human (His) is the recombinant human-derived ZBP1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ZBP1 is an important innate sensor that defends against viruses by recognizing Z-RNA structures and inducing PANoptosis. It binds Z-RNA through TNF-α family members and stimulates RIPK3 and MLKL to activate necroptosis. ZBP1 Protein, Human (His) is the recombinant human-derived ZBP1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

ZBP1, a pivotal innate sensor, plays a crucial role in host defense against various viruses by recognizing and binding to Z-RNA structures produced by pathogens such as herpesvirus, orthomyxovirus, and flavivirus. This recognition triggers a spectrum of cell death responses, including pyroptosis, necroptosis, and apoptosis, collectively referred to as PANoptosis. ZBP1 serves as a key activator of necroptosis, particularly in response to death-inducing TNF-alpha family members, by binding Z-RNA and subsequently stimulating RIPK3 kinase, leading to the phosphorylation and activation of MLKL, ultimately executing programmed necrosis. Moreover, in the context of orthomyxovirus infection, ZBP1 detects Z-RNA structures in infected nuclei, activating RIPK3 and promoting MLKL phosphorylation, resulting in the disruption of the nuclear envelope and release of cellular DNA into the cytosol. ZBP1's role extends beyond direct pathogen sensing, as it is involved in PANoptosis triggered by bacterial and fungal infections. Notably, in response to Zika virus infection, ZBP1, in conjunction with RIPK3, initiates a death-independent transcriptional program that restricts viral replication by modifying cellular metabolism. However, in the case of herpes simplex virus 1 (HHV-1) infection, ZBP1 may form hetero-amyloid structures with HHV-1 protein RIR1/ICP6, potentially inhibiting ZBP1-mediated necroptosis and allowing viral evasion of host cell death pathways.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9H171-1 (M1-S149)

Gene ID
Molecular Construction
N-term
ZBP1 (M1-S149)
Accession # Q9H171-1
6*His
C-term
Protein Length

Partial

Synonyms
Z-DNA-Binding Protein 1; Tumor Stroma and Activated Macrophage Protein DLM; ZBP1; C20orf183; DLM1
AA Sequence

MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKS

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ZBP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ZBP1 Protein, Human (His)
Cat. No.:
HY-P71436
Quantity:
MCE Japan Authorized Agent: