1. Recombinant Proteins
  2. Others
  3. YY1 Protein, Human (His)

The multifunctional transcription factor YY1 controls a variety of cellular and viral genes by binding to sites that overlap with the transcription start site. YY1 recognizes the consensus sequence 5'-CCGCCATNTT-3' and exhibits context-dependent transcriptional regulation, with methylation of the initial CG dinucleotide affecting binding affinity. YY1 Protein, Human (His) is the recombinant human-derived YY1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE YY1 Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The multifunctional transcription factor YY1 controls a variety of cellular and viral genes by binding to sites that overlap with the transcription start site. YY1 recognizes the consensus sequence 5'-CCGCCATNTT-3' and exhibits context-dependent transcriptional regulation, with methylation of the initial CG dinucleotide affecting binding affinity. YY1 Protein, Human (His) is the recombinant human-derived YY1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

YY1, a multifunctional transcription factor, exerts both positive and negative control over a plethora of cellular and viral genes by binding to sites overlapping the transcription start site. Recognizing the consensus sequence 5'-CCGCCATNTT-3', YY1 may engage in enhanced binding with some genes that harbor a longer motif, with methylation of the initial CG dinucleotide markedly reducing binding affinity. The impact on transcriptional regulation varies based on the context in which YY1 binds, featuring diverse mechanisms such as direct activation or repression, indirect modulation through cofactor recruitment, and activation or repression via the disruption of binding sites or conformational DNA changes. YY1's activity is intricately regulated by transcription factors and cytoplasmic proteins, which can either abrogate or completely inhibit its mediated activation or repression. Notably, it acts as a repressor in the absence of adenovirus E1A protein but transforms into an activator in its presence. Collaborating with SMAD1 and SMAD4, YY1 participates in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression by binding to SMAD binding elements within BMP response elements. YY1 is implicated in development, differentiation, and proposed to recruit the PRC2/EED-EZH2 complex to target genes undergoing transcriptional repression. Furthermore, YY1 plays a role in DNA repair, exhibiting a propensity to bind to DNA recombination intermediate structures, and contributes to the regulation of enhancer activation. It is proposed as a core component of the chromatin remodeling INO80 complex, targeting this complex to YY1-responsive elements involved in transcriptional regulation, DNA replication, and potentially DNA repair.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P25490 (V221-G321)

Gene ID
Molecular Construction
N-term
YY1 (V221-G321)
Accession # P25490
6*His
C-term
Protein Length

Partial

Synonyms
Transcriptional repressor protein YY1; Delta transcription factor; INO80 complex subunit S; NF-E1; Yin and yang 1; INO80S
AA Sequence

VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHG

Molecular Weight

17-20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

YY1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
YY1 Protein, Human (His)
Cat. No.:
HY-P71136
Quantity:
MCE Japan Authorized Agent: