1. Recombinant Proteins
  2. Others
  3. YTHDF2 Protein, Human (His)

YTHDF2 Protein, Human (His) is the recombinant human-derived YTHDF2, expressed by E. coli , with C-6*His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

YTHDF2 Protein, Human (His) is the recombinant human-derived YTHDF2, expressed by E. coli , with C-6*His labeled tag. ,

Background

YTHDF2 is a protein that specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, regulating their stability and participating in various biological processes. m6A is an internal modification in mRNAs and some non-coding RNAs that influences mRNA stability and processing. YTHDF2 promotes degradation of m6A-containing mRNAs by interacting with either the CCR4-NOT complex or the ribonuclease P/MRP complex, depending on context. The YTHDF paralogs (YTHDF1, YTHDF2, and YTHDF3) share m6A-containing mRNA targets and redundantly mediate mRNA degradation and cellular differentiation. For mRNAs containing the RIDA/HRSP12 binding site (5'-GGUUC-3'), YTHDF2 cooperatively binds with RIDA/HRSP12 to recruit the ribonuclease P/MRP complex for endoribonucleolytic cleavage, while other m6A-containing mRNAs undergo deadenylation via YTHDF2-CNOT1 interaction and CCR4-NOT recruitment. During oocyte maturation, YTHDF2 regulates maternal transcript dosage by binding m6A-containing mRNAs (by similar). In spermatogenesis, it promotes degradation of m6A-containing transcripts encoding matrix metallopeptidases to regulate spermatogonial adhesion (by similar). Additionally, YTHDF2 is involved in hematopoietic stem cell specification, neural development, circadian regulation of hepatic lipid metabolism, inhibition of type I interferon response, cap-independent translation during heat shock, mitotic entry regulation, and formation of phase-separated membraneless compartments. It may also recognize m5C-modified RNAs and regulate rRNA processing. During viral infection, YTHDF2 binds m6A-modified viral RNAs to promote gene expression and replication of SV40 and KSHV.

Biological Activity

Immobilized Human YTHDF2 at 5 μg/mL (100 μL/Well) on the plate can bind Anti-YTHDF2 antibody. The ED50 for this effect is 0.03 μg/mL.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9Y5A9 (S2-K579)

Gene ID

51441

Protein Length

Full Length of Mature Protein

Synonyms
DF2; CLL-associated antigen KW-14; High-glucose-regulated protein 8; Renal carcinoma antigen NY-REN-2
AA Sequence

SASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK

Molecular Weight

Approximately 65-68.2 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

YTHDF2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
YTHDF2 Protein, Human (His)
Cat. No.:
HY-P702576
Quantity:
MCE Japan Authorized Agent: