1. Recombinant Proteins
  2. Others
  3. YTFE Protein, E.coli (GST)

YTFE protein is a diiron-containing molecule that is crucially involved in the repair of iron-sulfur clusters under oxidative and nitrosative stress conditions. As a homodimer, YTFE plays a key role in mitigating damage to iron-sulfur clusters, a process necessary to maintain the integrity and function of various proteins within cells. YTFE Protein, E.coli (GST) is the recombinant E. coli-derived YTFE protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

YTFE protein is a diiron-containing molecule that is crucially involved in the repair of iron-sulfur clusters under oxidative and nitrosative stress conditions. As a homodimer, YTFE plays a key role in mitigating damage to iron-sulfur clusters, a process necessary to maintain the integrity and function of various proteins within cells. YTFE Protein, E.coli (GST) is the recombinant E. coli-derived YTFE protein, expressed by E. coli , with N-GST labeled tag.

Background

YTFE, a di-iron-containing protein, plays a vital role in the repair of iron-sulfur clusters that are susceptible to damage under conditions of oxidative and nitrosative stress. Operating as a homodimer, YTFE is implicated in cellular responses to environmental stresses that may compromise the integrity of iron-sulfur clusters, critical co-factors in various biological processes. The di-iron centers within YTFE likely contribute to its function as a repair enzyme, facilitating the restoration of damaged iron-sulfur clusters and ensuring the proper functioning of proteins dependent on these clusters for their activities.

Species

E.coli

Source

E. coli

Tag

N-GST

Accession

P69506 (M1-E220)

Gene ID

66671871  [NCBI]

Molecular Construction
N-term
GST
YTFE (M1-E220)
Accession # P69506
C-term
Protein Length

Full Length

Synonyms
Iron-sulfur cluster repair protein YtfE; Regulator of cell morphogenesis and NO signaling; RCMNS
AA Sequence

MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAEQPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLTMLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE

Predicted Molecular Mass
51.9 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

YTFE Protein, E.coli (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
YTFE Protein, E.coli (GST)
Cat. No.:
HY-P700386
Quantity:
MCE Japan Authorized Agent: