1. Recombinant Proteins
  2. Others
  3. YAP1 Protein, Human (His)

YAP1 is a multifunctional transcriptional regulator and an important downstream target in the Hippo signaling pathway, affecting organ size control and tumor suppression through proliferation and apoptosis regulation. STK3/MST2 and STK4/MST1 phosphorylate together with SAV1, inactivating YAP1 and WWTR1/TAZ oncoproteins. YAP1 Protein, Human (His) is the recombinant human-derived YAP1 protein, expressed by E. coli, with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

YAP1 is a multifunctional transcriptional regulator and an important downstream target in the Hippo signaling pathway, affecting organ size control and tumor suppression through proliferation and apoptosis regulation. STK3/MST2 and STK4/MST1 phosphorylate together with SAV1, inactivating YAP1 and WWTR1/TAZ oncoproteins. YAP1 Protein, Human (His) is the recombinant human-derived YAP1 protein, expressed by E. coli, with C-10*His labeled tag.

Background

YAP1, a multifaceted transcriptional regulator, serves as a critical downstream target in the Hippo signaling pathway, orchestrating organ size control and tumor suppression by modulating proliferation and apoptosis. The pathway involves a kinase cascade where STK3/MST2 and STK4/MST1, in coordination with SAV1, phosphorylate and activate LATS1/2, leading to the phosphorylation and inactivation of YAP1 and WWTR1/TAZ oncoproteins. YAP1 is pivotal in regulating tissue tension and 3D tissue shape by influencing cortical actomyosin network formation through ARHGAP18. Moreover, it plays a key role in controlling cell proliferation, with its nuclear translocation inhibited by LATS1/2 phosphorylation. YAP1's collaboration with TEAD transcription factors is essential for stimulating gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Additionally, it suppresses ciliogenesis by acting as a transcriptional corepressor of TEAD4 target genes AURKA and PLK1, and in conjunction with WWTR1, it regulates TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation. YAP1 further activates the C-terminal fragment (CTF) of ERBB4 isoform 3.

Species

Human

Source

E. coli

Tag

C-10*His

Accession

P46937 (M1-L504)

Gene ID

10413

Molecular Construction
N-term
YAP1 (M1-L504)
Accession # P46937
10*His
C-term
Protein Length

Full Length

Synonyms
Yes-associated protein 1; Protein yorkie homolog; Yes-associated protein YAP65 homolog; YAP65; YAP1
AA Sequence

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Predicted Molecular Mass
64.2 kDa
Molecular Weight

Approximately 72 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

YAP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
YAP1 Protein, Human (His)
Cat. No.:
HY-P704253
Quantity:
MCE Japan Authorized Agent: