1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. XTP3TPA Protein, Human (His)

XTP3TPA protein crucially hydrolyzes deoxynucleoside triphosphates (dNTPs), particularly preferring dCTP and its analogs, like 5-iodo-dCTP and 5-methyl-dCTP. This selective hydrolysis, reflecting high efficiency, likely safeguards against the incorporation of genotoxic nucleotide analogs into DNA or RNA, contributing to genomic integrity and protecting cellular nucleotide pools. XTP3TPA Protein, Human (His) is the recombinant human-derived XTP3TPA protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

XTP3TPA protein crucially hydrolyzes deoxynucleoside triphosphates (dNTPs), particularly preferring dCTP and its analogs, like 5-iodo-dCTP and 5-methyl-dCTP. This selective hydrolysis, reflecting high efficiency, likely safeguards against the incorporation of genotoxic nucleotide analogs into DNA or RNA, contributing to genomic integrity and protecting cellular nucleotide pools. XTP3TPA Protein, Human (His) is the recombinant human-derived XTP3TPA protein, expressed by E. coli , with N-His labeled tag.

Background

XTP3TPA protein plays a crucial role in cellular processes by hydrolyzing deoxynucleoside triphosphates (dNTPs) to their corresponding nucleoside monophosphates. This enzyme exhibits a robust preference for dCTP and its analogs, such as 5-iodo-dCTP and 5-methyl-dCTP, showcasing high efficiency, possibly serving as a protective mechanism against the incorporation of genotoxic nucleotide analogs into DNA or RNA. The selective hydrolysis of these nucleotide triphosphates by XTP3TPA contributes to the maintenance of genomic integrity and may play a role in safeguarding cellular nucleotide pools from potentially harmful analogs.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9H773 (M1-T170)

Gene ID
Molecular Construction
N-term
His
XTP3TPA (M1-T170)
Accession # Q9H773
C-term
Protein Length

Full Length

Synonyms
dCTP pyrophosphatase 1; dCTPase 1; RS21C6; DCTPP1; CDA03
AA Sequence

MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

Molecular Weight

Approximately 19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

XTP3TPA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
XTP3TPA Protein, Human (His)
Cat. No.:
HY-P77508
Quantity:
MCE Japan Authorized Agent: