1. Recombinant Proteins
  2. Others
  3. WIF-1 Protein, Human (HEK293, His)

WIF-1 protein critically binds to WNT protein, inhibits its activity and regulates the WNT signaling pathway. In addition to its inhibitory role, WIF-1 may also contribute to mesoderm segmentation, implicating its role in embryonic development. WIF-1 Protein, Human (HEK293, His) is the recombinant human-derived WIF-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE WIF-1 Protein, Human (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

WIF-1 protein critically binds to WNT protein, inhibits its activity and regulates the WNT signaling pathway. In addition to its inhibitory role, WIF-1 may also contribute to mesoderm segmentation, implicating its role in embryonic development. WIF-1 Protein, Human (HEK293, His) is the recombinant human-derived WIF-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The WIF-1 protein plays a crucial role as it binds to WNT proteins, effectively inhibiting their activities. This interaction suggests a pivotal regulatory function in WNT signaling pathways. Beyond its inhibitory role, WIF-1 may also be involved in mesoderm segmentation, hinting at its potential contributions to embryonic development. Furthermore, WIF-1 interacts with MYOC, indicating a possible association with additional cellular processes or signaling cascades. The multifaceted interactions of WIF-1 underscore its importance in modulating WNT-mediated activities and its potential involvement in broader developmental and cellular events.

Biological Activity

1.Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 this effect is 0.1022-0.1136 μg/mL in the presence of 20 ng/mL Recombinant Human Wnt-3a, corresponding to a specific activity is 8802.8169-9784.7358 units/mg.
2.Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is ≤0.5 μg/mL in the presence of 10 ng/mL Recombinant Human Wnt-3a, corresponding to a specific activity is ≥2×103 U/mg.

  • Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 0.1022 μg/mL in the presence of 20 ng/mL Recombinant Human Wnt-3a, corresponding to a specific activity is 9784.7358 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH18037.1 (G29-W379)

Gene ID
Molecular Construction
N-term
WIF-1 (G29-W379)
Accession # AAH18037.1
6*His
C-term
Protein Length

Partial

Synonyms
Wnt Inhibitory Factor 1; WIF-1; WIF1
AA Sequence

GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW

Molecular Weight

Approximately 42-48 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM HAc-NaAc, 150 mM NaCl, 0.5% CHAPS, pH 4.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or 20 mM Glycine-HCl, 10% Sucrose, 5% Mannitol , 0.05% Tween80, pH 3.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

WIF-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
WIF-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70982
Quantity:
MCE Japan Authorized Agent: