1. Recombinant Proteins
  2. Others
  3. WIBG Protein, Human (His)

WIBG is a central regulator of the exon junction complex (EJC) and serves as a critical EJC disassembly factor in post-transcriptional processes. WIBG is located upstream of exon-exon junctions on mRNA and destroys mature EJCs on spliced mRNAs during translation, thereby promoting the removal and recycling of EJCs. WIBG Protein, Human (His) is the recombinant human-derived WIBG protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

WIBG is a central regulator of the exon junction complex (EJC) and serves as a critical EJC disassembly factor in post-transcriptional processes. WIBG is located upstream of exon-exon junctions on mRNA and destroys mature EJCs on spliced mRNAs during translation, thereby promoting the removal and recycling of EJCs. WIBG Protein, Human (His) is the recombinant human-derived WIBG protein, expressed by E. coli , with C-6*His labeled tag.

Background

WIBG, a pivotal regulator of the exon junction complex (EJC), plays a central role in post-transcriptional processes within the cytoplasm, serving as a key component of the EJC, which associates immediately upstream of the exon-exon junction on mRNAs. Functioning as an EJC disassembly factor, WIBG facilitates translation-dependent EJC removal and recycling by disrupting mature EJC from spliced mRNAs. Its interaction with the 40S ribosomal subunit likely prevents translation-independent EJC disassembly, confining its activity to translated mRNAs. WIBG's involvement interferes with nonsense-mediated mRNA decay (NMD) and enhances the translation of spliced mRNAs, potentially through its antagonistic role against EJC functions. While its RNA-binding capability has been detected, the in vivo relevance of this interaction remains unclear. WIBG's direct interaction with MAGOH and RBM8A, along with its association with the 40S ribosomal subunit and the 48S preinitiation complex, underscores its intricate involvement in orchestrating post-transcriptional regulatory processes.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9BRP8 (M1-L204)

Gene ID
Molecular Construction
N-term
WIBG (M1-L204)
Accession # Q9BRP8
6*His
C-term
Protein Length

Full Length

Synonyms
Partner of Y14 and Mago; Protein Wibg Homolog; WIBG; PYM
AA Sequence

MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSRPEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL

Predicted Molecular Mass
23.7 kDa
Molecular Weight

Approximately 30 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

WIBG Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
WIBG Protein, Human (His)
Cat. No.:
HY-P71433
Quantity:
MCE Japan Authorized Agent: