1. Recombinant Proteins
  2. Others
  3. VSIG8 Protein, Mouse (HEK293, His)

VSIG8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG8 protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VSIG8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived VSIG8 protein, expressed by HEK293, with C-6*His labeled tag.

Background

V-set and immunoglobulin domain-containing protein 8 (VSIG8) is a membrane protein belonging to complement receptor of the immunoglobulin superfamily. VSIG8 has RNA binding activity and is a human T-cell co-inhibitory ligand. VSIG-8 inhibits the production of cytokines (IL-2, IFN-γ, IL-17, IL-6, and IL-19), chemokines (MCP-1, MCP-10, and IP-10) and other proteins (IGFBP3 and RBP4) on anti-CD3 activated human CD3 T cells. VSIG-8 significantly reduces the production of IFN-γand IL-2 on both CD4 and CD8 T cells in the presence of T-cell receptor signaling. VSIG-8 markedly suppresses anti-CD3-induced human T cell proliferation and profoundly decreases the conversion of naïve CD4+ T cells into Th1 cells[1][2].

Biological Activity

Measured by its ability to chemoattract Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.7887 μg/ml, corresponding to a specific activity is 1267.91 units/mg.

  • Measured by its ability to chemoattract Jurkat human T-lymphocyte leukemia cells. The ED50 this effect is 0.7887 μg/mL, corresponding to a specific activity is 1267.91 units/mg.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q6P3A4-1 (V22-G262)

Gene ID
Molecular Construction
N-term
VSIG8 (V22-G262)
Accession # Q6P3A4-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
V-set and immunoglobulin domain-containing protein 8; Vsig8
AA Sequence

VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVG

Molecular Weight

Approximately 27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VSIG8 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VSIG8 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72427A
Quantity:
MCE Japan Authorized Agent: