1. Recombinant Proteins
  2. Others
  3. VSIG1 Protein, Human (HEK293, His)

VSIG1 Protein is a member of the adhesion molecule (JAM) family and is expressed in the normal stomach and testes, as well as in cancers of the stomach, esophagus, and ovary. VSIG1 Protein mediates the activation of Wnt/尾-catenin signaling pathway, which has tumor inhibition function and reduces the proliferation and migration ability of tumor cells. VSIG1 Protein, Human (HEK293, His) is the recombinant human-derived VSIG1 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VSIG1 Protein is a member of the adhesion molecule (JAM) family and is expressed in the normal stomach and testes, as well as in cancers of the stomach, esophagus, and ovary. VSIG1 Protein mediates the activation of Wnt/尾-catenin signaling pathway, which has tumor inhibition function and reduces the proliferation and migration ability of tumor cells. VSIG1 Protein, Human (HEK293, His) is the recombinant human-derived VSIG1 protein, expressed by HEK293 , with N-His labeled tag.

Background

VSIG1 is a member of the adhesion molecule (JAM) family and is expressed in the normal stomach and testicles, as well as in cancers of the stomach, esophagus, and ovary. VSIG1 mediates activation of Wnt/β-catenin signaling pathway as a new target for epithelial-mesenchymal transformation in gastric cancer. VSIG1 has a tumor suppressor function, reducing the proliferation and migration ability of tumor cells[1][2][3][4][5].

Species

Human

Source

HEK293

Tag

N-His

Accession

Q86XK7-1 (V22-E232)

Gene ID
Molecular Construction
N-term
His
VSIG1 (V22-E232)
Accession # Q86XK7-1
C-term
Protein Length

Extracellular Domain

Synonyms
Cell surface A33 antigen; ChT1 thymocyte antigen; Glycoprotein A34; GPA34; MGC44287; OTTHUMP00000023820
AA Sequence

VQVTIPDGFVNVTVGSNVTLICIYTTTVASREQLSIQWSFFHKKEMEPISIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPVKENFNPTTGILVIGNLTNFEQGYYQCTAINRLGNSSCEIDLTSSHPE

Molecular Weight

Approximately 26.4 kDa

Glycosylation
Yes
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

VSIG1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VSIG1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71675
Quantity:
MCE Japan Authorized Agent: