Vpr Protein, HIV-1 group M subtype K (His, Myc)

Vpr Protein, HIV-1 group M subtype K (His, Myc) is the recombinant virus-derived Vpr protein, expressed by E. coli, with N-10*His & C-Myc tag.

Vpr is a protein that may deplete host UNG protein and induce G2-M cell cycle arrest during virus replication. It acts by targeting specific host proteins for degradation by the 26S proteasome through association with the cellular CUL4A-DDB1 E3 ligase complex via direct interaction with host VPRPB/DCAF-1. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting initiation by Vpr carried into the virion. Additionally, Vpr induces apoptosis in a cell cycle-dependent manner, indicating mechanistic linkage between these effects. Detected in AIDS patient serum and cerebrospinal fluid, Vpr may also induce bystander cell death.

Virus

E. coli

N-10*His;C-Myc

P0C1P2 (M1-S96)

Full Length

MEQAPEDQGPQREPNNEWTLEILEELKREAVRHFPRPWLHNLGQHIYTTYGDTWEGLEAIIRILQQLLFIHFRIGCHHSRIGIIPQRRGRNGSSRS

Greater than 85% as determined by SDS-PAGE.

<1 EU/μg, determined by LAL method.