1. Recombinant Proteins
  2. Receptor Proteins
  3. VLDLR Protein, Human (HEK293, His)

The VLDLR protein is a multifunctional receptor that mediates energy metabolism by binding VLDL and transporting it into cells. It interacts with Reelin/RELN, APOE-containing ligands and clusterin/CLU. VLDLR Protein, Human (HEK293, His) is the recombinant human-derived VLDLR protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The VLDLR protein is a multifunctional receptor that mediates energy metabolism by binding VLDL and transporting it into cells. It interacts with Reelin/RELN, APOE-containing ligands and clusterin/CLU. VLDLR Protein, Human (HEK293, His) is the recombinant human-derived VLDLR protein, expressed by HEK293 , with C-His labeled tag.

Background

VLDLR protein, a multifunctional cell surface receptor, plays a pivotal role in energy metabolism by binding to VLDL and facilitating its endocytic transport into cells. Beyond lipid transport, VLDLR exhibits versatile binding capabilities, interacting with a diverse array of molecules, including Reelin/RELN, apolipoprotein E/APOE-containing ligands, and clusterin/CLU. In its inactive state, VLDLR forms homooligomers or heterooligomers with LRP8. Upon ligand binding, homooligomers undergo rearrangement into higher order receptor clusters that transmit the extracellular RELN signal to intracellular signaling pathways by binding to DAB1. This interaction triggers the phosphorylation of DAB1, orchestrating the cellular responses necessary for the accurate positioning of newly generated neurons. Subsequently, VLDLR acts as a stop signal for migrating neurons, preventing their entry into the marginal zone. Notably, in the context of microbial infection, VLDLR serves as a receptor for Semliki Forest virus.

Biological Activity

Human VLDLR, His Tag immobilized on CM5 Chip can bind Human PCSK9, His Tag with an affinity constant of ≤0.72 nM as determined in SPR assay (Biacore T200).

Species

Human

Source

HEK293

Tag

C-His

Accession

P98155 (G28--S797)

Gene ID
Molecular Construction
N-term
VLDLR (G28--S797)
Accession # P98155
His
C-term
Synonyms
Very low-density lipoprotein receptor; VLDL-R
AA Sequence

GRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCSDGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCLPAPQINDHSPKYTCSCPSGYNVEENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGINVTTAVSEVSVPPKGTS

Molecular Weight

110-130 kDa (glycosylation)

Purity

Greater than 95% as determined by Tris-Bis PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VLDLR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VLDLR Protein, Human (HEK293, His)
Cat. No.:
HY-P76125
Quantity:
MCE Japan Authorized Agent: