1. Recombinant Proteins
  2. Complement System
  3. Complement Regulatory Proteins
  4. Vitronectin
  5. Vitronectin Protein, Human (417a.a)

Vitronectin is a multifunctional cell adhesion factor in serum and tissues that interacts with glycosaminoglycans and proteoglycans. It acts as an adhesion molecule between cells and the matrix, binding to specific integrins. Vitronectin Protein, Human (417a.a) is the recombinant human-derived Vitronectin protein, expressed by E. coli, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Vitronectin is a multifunctional cell adhesion factor in serum and tissues that interacts with glycosaminoglycans and proteoglycans. It acts as an adhesion molecule between cells and the matrix, binding to specific integrins. Vitronectin Protein, Human (417a.a) is the recombinant human-derived Vitronectin protein, expressed by E. coli, with tag free.

Background

Vitronectin Protein is a multifunctional cell adhesion and spreading factor present in serum and tissues. It interacts with glycosaminoglycans and proteoglycans and acts as a cell-to-substrate adhesion molecule, binding to specific integrins. Additionally, Vitronectin Protein functions as an inhibitor of the terminal cytolytic complement pathway, protecting cell membranes from damage. It also possesses protease-inhibiting activity and is involved in regulating growth hormone-dependent processes, specifically somatomedin-B.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P04004/AAH05046.1 (V62-L478)

Gene ID

7448

Molecular Construction
N-term
Vitronectin(V62-L478)
Accession # P04004
C-term
Protein Length

Partial

Synonyms
Vitronectin; VN; S-Protein; Serum-Spreading Factor; V75; VTN
AA Sequence

DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL

Predicted Molecular Mass
47.6 kDa
Molecular Weight

Approximately 46-58 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<0.01 EU/μg, determined by LAL method.

Documentation

Vitronectin Protein, Human (417a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Vitronectin Protein, Human (417a.a)
Cat. No.:
HY-P704067
Quantity:
MCE Japan Authorized Agent: