1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. VISTA
  5. VISTA/B7-H5 Protein, Rat (HEK293, Fc)

VISTA/B7-H5 protein, an immunoregulatory receptor, inhibits T-cell response and may regulate embryonic stem cell differentiation by inhibiting BMP4 signaling. It also stimulates MMP14-mediated MMP2 activation, suggesting a role in matrix metalloproteinase processes. These roles highlight the significance of VISTA/B7-H5 in immune regulation, embryonic development, and extracellular matrix dynamics. VISTA/B7-H5 Protein, Rat (HEK293, Fc) is the recombinant rat-derived VISTA/B7-H5 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VISTA/B7-H5 protein, an immunoregulatory receptor, inhibits T-cell response and may regulate embryonic stem cell differentiation by inhibiting BMP4 signaling. It also stimulates MMP14-mediated MMP2 activation, suggesting a role in matrix metalloproteinase processes. These roles highlight the significance of VISTA/B7-H5 in immune regulation, embryonic development, and extracellular matrix dynamics. VISTA/B7-H5 Protein, Rat (HEK293, Fc) is the recombinant rat-derived VISTA/B7-H5 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

VISTA/B7-H5 protein, functioning as an immunoregulatory receptor, plays a pivotal role in inhibiting the T-cell response, as established in various studies. Additionally, it may contribute to the differentiation of embryonic stem cells by inhibiting BMP4 signaling, showcasing its potential role in developmental processes. Moreover, VISTA/B7-H5 has been implicated in stimulating MMP14-mediated MMP2 activation, suggesting a regulatory function in matrix metalloproteinase-mediated processes. This multifaceted role underscores the significance of VISTA/B7-H5 in immune regulation, embryonic development, and extracellular matrix dynamics, revealing its potential impact across diverse biological contexts.

Biological Activity

Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion in Jurkat human T lymphocytes. The ED50 for this effect is 1.173 μg/mL in the presence of 5 μg/mL anti-CD3, corresponding to a specific activity is 852.515 U/mg.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

G3V9P3 (I33-A191)

Gene ID
Molecular Construction
N-term
VISTA (I33-A191)
Accession # G3V9P3
hFc
C-term
Synonyms
Platelet receptor Gi24; Stress-induced secreted protein-1; Sisp-1; C10orf54; SISP1
AA Sequence

IKVTTPYSLYVCPEGQNVTLTCRILDSVSKGHDANFLKTWFLSSRGEVQVCKEHRPIRNFISHHQHHRSHPAVNASHDQPQKHGLEIAYDNHGNFSITLHNVTLSDSGLYCCLVIEVKHHHPERRLYGYMELQVQTGKGSASTCTAYPPNEQDSDSITA

Molecular Weight

Approximately 60-75 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VISTA/B7-H5 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VISTA/B7-H5 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73546
Quantity:
MCE Japan Authorized Agent: